Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S8AT61

Protein Details
Accession S8AT61    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
39-60DYDKYRLERKYKRRMRHAGGHPBasic
NLS Segment(s)
PositionSequence
50-52KRR
Subcellular Location(s) mito 8, plas 8, nucl 5, pero 3, cyto 1, extr 1, golg 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MADPHSASTAEPAATHSSPIIREVKAKRPWPPDFSKMSDYDKYRLERKYKRRMRHAGGHPASWMKFTGILQILTVTALPAYMVLFMEWPMEHPFGPLRSWMWSKVDHLRGSKPTTTLSRGAASVENKNASAASGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.17
4 0.17
5 0.17
6 0.22
7 0.23
8 0.19
9 0.26
10 0.31
11 0.4
12 0.46
13 0.51
14 0.55
15 0.6
16 0.65
17 0.65
18 0.67
19 0.64
20 0.61
21 0.6
22 0.56
23 0.51
24 0.5
25 0.49
26 0.45
27 0.41
28 0.41
29 0.39
30 0.41
31 0.44
32 0.48
33 0.51
34 0.58
35 0.66
36 0.7
37 0.75
38 0.8
39 0.82
40 0.8
41 0.8
42 0.78
43 0.78
44 0.71
45 0.62
46 0.53
47 0.46
48 0.39
49 0.3
50 0.22
51 0.11
52 0.11
53 0.1
54 0.13
55 0.12
56 0.11
57 0.11
58 0.1
59 0.1
60 0.09
61 0.09
62 0.05
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.04
72 0.04
73 0.05
74 0.05
75 0.07
76 0.09
77 0.1
78 0.1
79 0.11
80 0.13
81 0.14
82 0.14
83 0.14
84 0.13
85 0.17
86 0.19
87 0.21
88 0.21
89 0.22
90 0.26
91 0.33
92 0.38
93 0.38
94 0.39
95 0.43
96 0.46
97 0.49
98 0.48
99 0.41
100 0.39
101 0.39
102 0.4
103 0.37
104 0.35
105 0.31
106 0.29
107 0.29
108 0.3
109 0.28
110 0.3
111 0.31
112 0.3
113 0.28
114 0.29
115 0.27