Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8BKE4

Protein Details
Accession S8BKE4    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-28RDEKANQKKDRKQEKKEKQTKNEDPFTTBasic
NLS Segment(s)
PositionSequence
9-16KDRKQEKK
Subcellular Location(s) nucl 18, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR007823  RRP8  
IPR042036  RRP8_N  
Gene Ontology GO:0005730  C:nucleolus  
GO:0008168  F:methyltransferase activity  
GO:0032259  P:methylation  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF05148  Methyltransf_8  
Amino Acid Sequences RDEKANQKKDRKQEKKEKQTKNEDPFTTALAAAATAVSETTIDTSSKAPTLTPLQEKMRQKLSGARFRHLNQLLYTTPSQDSLTLFKSQPEMFRDYHAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.92
3 0.94
4 0.94
5 0.92
6 0.92
7 0.92
8 0.89
9 0.86
10 0.76
11 0.69
12 0.59
13 0.51
14 0.41
15 0.3
16 0.21
17 0.12
18 0.11
19 0.07
20 0.06
21 0.04
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.04
28 0.05
29 0.05
30 0.06
31 0.07
32 0.08
33 0.09
34 0.09
35 0.08
36 0.09
37 0.12
38 0.15
39 0.16
40 0.2
41 0.23
42 0.3
43 0.34
44 0.35
45 0.38
46 0.35
47 0.34
48 0.37
49 0.42
50 0.44
51 0.44
52 0.43
53 0.42
54 0.43
55 0.52
56 0.47
57 0.41
58 0.33
59 0.35
60 0.32
61 0.31
62 0.3
63 0.23
64 0.21
65 0.19
66 0.19
67 0.16
68 0.17
69 0.16
70 0.19
71 0.2
72 0.2
73 0.2
74 0.24
75 0.25
76 0.29
77 0.3
78 0.32
79 0.29