Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S8AIU0

Protein Details
Accession S8AIU0    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
116-149ATPRRSPKVTKANTPRRRGRPPKNQKLKQVEEEEHydrophilic
NLS Segment(s)
PositionSequence
111-141AARAPATPRRSPKVTKANTPRRRGRPPKNQK
Subcellular Location(s) nucl 18.5, mito_nucl 13, mito 6.5
Family & Domain DBs
Amino Acid Sequences MAPTNASVLSPSKEKPYESFAKKTKSVEVLVTVLLSSKKADAFGLDSAQVDWNLVAHRLSLKSAKVASTRFGQVKKELLDCAAAMNMLSKQHKPSDESEGELTPPETPVKAARAPATPRRSPKVTKANTPRRRGRPPKNQKLKQVEEEEAEEEEVQIAEPEEETPSEGEQSTDADVSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.32
3 0.37
4 0.44
5 0.46
6 0.54
7 0.53
8 0.57
9 0.6
10 0.59
11 0.57
12 0.52
13 0.48
14 0.41
15 0.37
16 0.32
17 0.27
18 0.25
19 0.18
20 0.15
21 0.13
22 0.12
23 0.09
24 0.09
25 0.09
26 0.1
27 0.1
28 0.1
29 0.12
30 0.13
31 0.14
32 0.13
33 0.12
34 0.13
35 0.14
36 0.12
37 0.09
38 0.08
39 0.07
40 0.07
41 0.08
42 0.07
43 0.07
44 0.09
45 0.09
46 0.11
47 0.13
48 0.13
49 0.15
50 0.16
51 0.18
52 0.19
53 0.2
54 0.2
55 0.2
56 0.24
57 0.25
58 0.26
59 0.26
60 0.25
61 0.28
62 0.27
63 0.26
64 0.22
65 0.19
66 0.17
67 0.15
68 0.13
69 0.09
70 0.07
71 0.05
72 0.05
73 0.06
74 0.07
75 0.09
76 0.09
77 0.11
78 0.14
79 0.16
80 0.18
81 0.2
82 0.25
83 0.25
84 0.26
85 0.25
86 0.23
87 0.22
88 0.19
89 0.17
90 0.09
91 0.1
92 0.08
93 0.07
94 0.07
95 0.09
96 0.12
97 0.13
98 0.15
99 0.16
100 0.21
101 0.26
102 0.34
103 0.4
104 0.42
105 0.46
106 0.5
107 0.52
108 0.51
109 0.56
110 0.58
111 0.55
112 0.6
113 0.65
114 0.71
115 0.75
116 0.8
117 0.8
118 0.79
119 0.85
120 0.86
121 0.86
122 0.86
123 0.88
124 0.91
125 0.92
126 0.91
127 0.9
128 0.89
129 0.85
130 0.82
131 0.77
132 0.68
133 0.6
134 0.55
135 0.46
136 0.37
137 0.31
138 0.22
139 0.16
140 0.13
141 0.11
142 0.08
143 0.07
144 0.07
145 0.06
146 0.06
147 0.07
148 0.08
149 0.08
150 0.09
151 0.1
152 0.1
153 0.12
154 0.12
155 0.12
156 0.11
157 0.12
158 0.13