Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S8APF8

Protein Details
Accession S8APF8    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
49-69LREIRKRERIQQQDRKKEERRBasic
NLS Segment(s)
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039730  Jlp2/Ccd25  
Amino Acid Sequences MAVGQVGFKDTKKVKRIMVVQRENPIVNRLNKTKKEENPDLYQQREDHLREIRKRERIQQQDRKKEERRVEQERQEIKYQKEHAYDEWNDEGAMVGTSNKHGQSYSDFEDDFM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.54
3 0.62
4 0.65
5 0.69
6 0.69
7 0.67
8 0.67
9 0.66
10 0.59
11 0.51
12 0.45
13 0.4
14 0.37
15 0.38
16 0.4
17 0.47
18 0.51
19 0.58
20 0.62
21 0.62
22 0.66
23 0.68
24 0.65
25 0.62
26 0.65
27 0.62
28 0.55
29 0.52
30 0.43
31 0.37
32 0.37
33 0.32
34 0.27
35 0.29
36 0.34
37 0.36
38 0.44
39 0.49
40 0.52
41 0.53
42 0.57
43 0.6
44 0.63
45 0.69
46 0.71
47 0.75
48 0.76
49 0.8
50 0.8
51 0.77
52 0.75
53 0.72
54 0.72
55 0.71
56 0.69
57 0.71
58 0.69
59 0.72
60 0.69
61 0.65
62 0.62
63 0.58
64 0.52
65 0.52
66 0.5
67 0.46
68 0.45
69 0.43
70 0.38
71 0.41
72 0.39
73 0.36
74 0.33
75 0.28
76 0.24
77 0.21
78 0.19
79 0.12
80 0.11
81 0.07
82 0.06
83 0.06
84 0.09
85 0.12
86 0.12
87 0.13
88 0.13
89 0.15
90 0.2
91 0.26
92 0.29
93 0.3