Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8C2R3

Protein Details
Accession S8C2R3    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
125-163VGERRGRKKKEEPVAPKKAAPKKAATSKRGKKVEKEEEPBasic
NLS Segment(s)
PositionSequence
67-157AAPVKRGRGRPPKPGGPAPKRPVVLTASGEPRKRGRPRKEEGAEPKAKVAKTTKSTSPVGERRGRKKKEEPVAPKKAAPKKAATSKRGKKV
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Amino Acid Sequences MAASKLQNLAGYASAAFKSATSAVTSATTFPKDADEPNSSSPAPDVDNAADKADAKTDKKDDAPAAAAPVKRGRGRPPKPGGPAPKRPVVLTASGEPRKRGRPRKEEGAEPKAKVAKTTKSTSPVGERRGRKKKEEPVAPKKAAPKKAATSKRGKKVEKEEEPEEEPEEDAEEDEDAEEEDDDEEEDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.11
4 0.09
5 0.11
6 0.11
7 0.11
8 0.11
9 0.11
10 0.11
11 0.13
12 0.14
13 0.13
14 0.16
15 0.16
16 0.15
17 0.15
18 0.18
19 0.17
20 0.2
21 0.23
22 0.24
23 0.26
24 0.29
25 0.32
26 0.28
27 0.27
28 0.24
29 0.2
30 0.18
31 0.15
32 0.14
33 0.12
34 0.16
35 0.16
36 0.17
37 0.16
38 0.15
39 0.14
40 0.17
41 0.19
42 0.17
43 0.22
44 0.24
45 0.26
46 0.27
47 0.3
48 0.27
49 0.25
50 0.25
51 0.2
52 0.2
53 0.21
54 0.2
55 0.18
56 0.2
57 0.22
58 0.23
59 0.25
60 0.32
61 0.39
62 0.44
63 0.52
64 0.57
65 0.59
66 0.62
67 0.66
68 0.67
69 0.64
70 0.68
71 0.62
72 0.6
73 0.54
74 0.49
75 0.44
76 0.36
77 0.3
78 0.23
79 0.22
80 0.23
81 0.27
82 0.27
83 0.27
84 0.28
85 0.34
86 0.41
87 0.48
88 0.51
89 0.57
90 0.62
91 0.71
92 0.71
93 0.71
94 0.7
95 0.69
96 0.64
97 0.55
98 0.52
99 0.45
100 0.42
101 0.37
102 0.33
103 0.31
104 0.32
105 0.36
106 0.36
107 0.37
108 0.39
109 0.38
110 0.43
111 0.41
112 0.43
113 0.47
114 0.51
115 0.56
116 0.65
117 0.68
118 0.67
119 0.71
120 0.73
121 0.75
122 0.78
123 0.78
124 0.78
125 0.82
126 0.77
127 0.71
128 0.71
129 0.69
130 0.66
131 0.6
132 0.56
133 0.55
134 0.63
135 0.68
136 0.67
137 0.69
138 0.72
139 0.78
140 0.81
141 0.77
142 0.75
143 0.77
144 0.8
145 0.79
146 0.76
147 0.7
148 0.66
149 0.65
150 0.58
151 0.5
152 0.4
153 0.31
154 0.24
155 0.21
156 0.16
157 0.13
158 0.11
159 0.09
160 0.08
161 0.08
162 0.08
163 0.07
164 0.07
165 0.07
166 0.06
167 0.07
168 0.07