Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8AUV9

Protein Details
Accession S8AUV9    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-48MTAVKHVPIVKKHRKRFNRHQSDRFKCVDPSWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
11-18KKHRKRFN
32-53WRKPKGIDNRVRRRFKGQAAMP
Subcellular Location(s) mito 16.5, mito_nucl 11.666, cyto_nucl 6.333, nucl 5.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MTAVKHVPIVKKHRKRFNRHQSDRFKCVDPSWRKPKGIDNRVRRRFKGQAAMPKIGYGSNKKTKHMMPSGHKAFLVHNVNDVDLLLMHNHTFAAEISHAVSSRKRIEIIAKAKTLGVKVTNPKGRVTTGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.88
3 0.9
4 0.91
5 0.91
6 0.91
7 0.92
8 0.92
9 0.9
10 0.86
11 0.79
12 0.7
13 0.61
14 0.55
15 0.55
16 0.52
17 0.54
18 0.58
19 0.61
20 0.59
21 0.59
22 0.65
23 0.66
24 0.67
25 0.67
26 0.68
27 0.72
28 0.81
29 0.84
30 0.77
31 0.73
32 0.69
33 0.65
34 0.63
35 0.58
36 0.58
37 0.57
38 0.58
39 0.5
40 0.44
41 0.38
42 0.31
43 0.27
44 0.22
45 0.23
46 0.3
47 0.32
48 0.33
49 0.36
50 0.37
51 0.41
52 0.42
53 0.42
54 0.38
55 0.46
56 0.48
57 0.45
58 0.43
59 0.37
60 0.32
61 0.33
62 0.31
63 0.22
64 0.22
65 0.21
66 0.21
67 0.2
68 0.19
69 0.11
70 0.07
71 0.07
72 0.05
73 0.05
74 0.05
75 0.05
76 0.05
77 0.05
78 0.05
79 0.05
80 0.07
81 0.07
82 0.07
83 0.08
84 0.09
85 0.1
86 0.11
87 0.13
88 0.16
89 0.2
90 0.21
91 0.21
92 0.22
93 0.28
94 0.36
95 0.42
96 0.43
97 0.41
98 0.39
99 0.4
100 0.4
101 0.35
102 0.29
103 0.26
104 0.26
105 0.33
106 0.42
107 0.48
108 0.47
109 0.49
110 0.48