Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RRF6

Protein Details
Accession F4RRF6    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-32AAASSSHRAQKKKKWSKGKVKDKANNAVVHydrophilic
NLS Segment(s)
PositionSequence
11-25RAQKKKKWSKGKVKD
Subcellular Location(s) nucl 12.5mito_nucl 12.5, mito 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG mlr:MELLADRAFT_37066  -  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences KAAAAASSSHRAQKKKKWSKGKVKDKANNAVVVDKPTFDKIFKEVPTYKMISQSVLIDRMKINGSLARVAIQHLEREGLIKRIVHHRGQLVYSKEHRQVVNQNHKLMRFIGLARSLDFFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.69
3 0.77
4 0.81
5 0.86
6 0.9
7 0.93
8 0.94
9 0.92
10 0.92
11 0.9
12 0.86
13 0.84
14 0.76
15 0.69
16 0.58
17 0.52
18 0.43
19 0.38
20 0.31
21 0.22
22 0.2
23 0.19
24 0.2
25 0.16
26 0.17
27 0.17
28 0.22
29 0.22
30 0.27
31 0.27
32 0.28
33 0.31
34 0.33
35 0.3
36 0.29
37 0.28
38 0.22
39 0.21
40 0.2
41 0.17
42 0.19
43 0.18
44 0.14
45 0.14
46 0.15
47 0.14
48 0.12
49 0.12
50 0.09
51 0.1
52 0.1
53 0.1
54 0.1
55 0.09
56 0.1
57 0.12
58 0.11
59 0.1
60 0.1
61 0.1
62 0.09
63 0.11
64 0.11
65 0.11
66 0.12
67 0.13
68 0.15
69 0.23
70 0.27
71 0.28
72 0.3
73 0.32
74 0.33
75 0.34
76 0.38
77 0.33
78 0.35
79 0.37
80 0.39
81 0.4
82 0.43
83 0.41
84 0.4
85 0.46
86 0.51
87 0.58
88 0.57
89 0.59
90 0.58
91 0.59
92 0.55
93 0.47
94 0.4
95 0.32
96 0.28
97 0.26
98 0.28
99 0.28
100 0.28