Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8BT67

Protein Details
Accession S8BT67   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
140-166EVETKKEWNKGKKIEKKSTKEREHEGKBasic
NLS Segment(s)
PositionSequence
145-162KEWNKGKKIEKKSTKERE
Subcellular Location(s) cyto 18, cyto_nucl 13.333, nucl 6.5, mito_nucl 4.166
Family & Domain DBs
Amino Acid Sequences MADASQVHADVESLVEKFDVLGRIDAIEKADEPVVVPVTFVVETDVTIELDAEKSKFSSSTKAPSSVSKGETEFTVTQGDELKYNVTAGDVKGDFKIKFDIDDSAPKLKLGDELEDGDKTGLGFETTKVTKKVEIELKSEVETKKEWNKGKKIEKKSTKEREHEGKAGGYEYEFKEQVKYKQEKDEFEYQVEKETEIEAKSVKITWRIY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.08
5 0.11
6 0.13
7 0.12
8 0.13
9 0.13
10 0.15
11 0.16
12 0.16
13 0.14
14 0.13
15 0.12
16 0.12
17 0.12
18 0.11
19 0.11
20 0.12
21 0.13
22 0.12
23 0.11
24 0.09
25 0.11
26 0.11
27 0.1
28 0.1
29 0.07
30 0.07
31 0.09
32 0.1
33 0.08
34 0.08
35 0.08
36 0.07
37 0.08
38 0.09
39 0.08
40 0.07
41 0.08
42 0.08
43 0.1
44 0.11
45 0.16
46 0.18
47 0.26
48 0.28
49 0.3
50 0.31
51 0.33
52 0.37
53 0.36
54 0.34
55 0.28
56 0.26
57 0.24
58 0.23
59 0.24
60 0.19
61 0.16
62 0.15
63 0.13
64 0.13
65 0.15
66 0.15
67 0.11
68 0.11
69 0.11
70 0.09
71 0.1
72 0.09
73 0.06
74 0.07
75 0.06
76 0.1
77 0.09
78 0.1
79 0.11
80 0.14
81 0.14
82 0.14
83 0.16
84 0.12
85 0.13
86 0.13
87 0.14
88 0.12
89 0.17
90 0.18
91 0.18
92 0.18
93 0.17
94 0.17
95 0.15
96 0.16
97 0.13
98 0.13
99 0.11
100 0.13
101 0.14
102 0.14
103 0.14
104 0.1
105 0.1
106 0.08
107 0.06
108 0.05
109 0.04
110 0.05
111 0.05
112 0.1
113 0.11
114 0.14
115 0.15
116 0.16
117 0.18
118 0.19
119 0.25
120 0.28
121 0.3
122 0.3
123 0.32
124 0.32
125 0.31
126 0.35
127 0.29
128 0.23
129 0.22
130 0.24
131 0.28
132 0.35
133 0.41
134 0.45
135 0.53
136 0.61
137 0.7
138 0.75
139 0.77
140 0.8
141 0.84
142 0.84
143 0.86
144 0.88
145 0.86
146 0.82
147 0.8
148 0.79
149 0.75
150 0.7
151 0.61
152 0.52
153 0.44
154 0.39
155 0.31
156 0.22
157 0.2
158 0.19
159 0.21
160 0.19
161 0.19
162 0.23
163 0.28
164 0.33
165 0.39
166 0.44
167 0.44
168 0.54
169 0.59
170 0.58
171 0.6
172 0.63
173 0.56
174 0.53
175 0.52
176 0.42
177 0.44
178 0.4
179 0.34
180 0.25
181 0.24
182 0.23
183 0.2
184 0.21
185 0.15
186 0.16
187 0.17
188 0.19
189 0.21