Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8ANK3

Protein Details
Accession S8ANK3   
Localization Confidence Low
Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
129-148PSKPWGKWPKWKQVDGKEAPHydrophilic
NLS Segment(s)
PositionSequence
132-162PWGKWPKWKQVDGKEAPRPVRKRPEGAVPPR
Subcellular Location(s) plas 7, mito 6, extr 6, E.R. 5, cyto_nucl 2, nucl 1.5, cyto 1.5
Family & Domain DBs
Amino Acid Sequences MHLAKAITIVLSVAGAAVAVAVPEEPTTTCHGQKLAIRETPAAPSTSCTGGMKLVKKETPTTSCHGMKKIKARETPAPEPTTSCHGMKKLKPRDTTLTKSCTGMRKLAVRETPASEASSVETDKPVAMPSKPWGKWPKWKQVDGKEAPRPVRKRPEGAVPPRPTISKLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.03
5 0.02
6 0.02
7 0.03
8 0.03
9 0.03
10 0.04
11 0.05
12 0.05
13 0.08
14 0.13
15 0.17
16 0.18
17 0.2
18 0.21
19 0.23
20 0.26
21 0.31
22 0.31
23 0.31
24 0.31
25 0.31
26 0.32
27 0.32
28 0.3
29 0.24
30 0.18
31 0.17
32 0.18
33 0.17
34 0.17
35 0.14
36 0.13
37 0.16
38 0.21
39 0.24
40 0.25
41 0.28
42 0.28
43 0.3
44 0.33
45 0.34
46 0.33
47 0.32
48 0.32
49 0.35
50 0.38
51 0.39
52 0.41
53 0.4
54 0.41
55 0.47
56 0.51
57 0.51
58 0.5
59 0.53
60 0.55
61 0.58
62 0.59
63 0.55
64 0.49
65 0.42
66 0.39
67 0.35
68 0.32
69 0.27
70 0.22
71 0.18
72 0.2
73 0.25
74 0.29
75 0.38
76 0.43
77 0.48
78 0.5
79 0.53
80 0.57
81 0.59
82 0.61
83 0.56
84 0.51
85 0.44
86 0.43
87 0.42
88 0.4
89 0.35
90 0.31
91 0.29
92 0.3
93 0.31
94 0.35
95 0.34
96 0.31
97 0.31
98 0.31
99 0.3
100 0.26
101 0.24
102 0.19
103 0.17
104 0.15
105 0.15
106 0.13
107 0.11
108 0.1
109 0.1
110 0.1
111 0.1
112 0.11
113 0.11
114 0.11
115 0.13
116 0.18
117 0.28
118 0.28
119 0.36
120 0.43
121 0.47
122 0.57
123 0.64
124 0.69
125 0.68
126 0.75
127 0.76
128 0.77
129 0.82
130 0.79
131 0.79
132 0.75
133 0.74
134 0.74
135 0.74
136 0.69
137 0.68
138 0.71
139 0.69
140 0.67
141 0.64
142 0.68
143 0.69
144 0.74
145 0.75
146 0.69
147 0.67
148 0.64
149 0.61