Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S8AKR0

Protein Details
Accession S8AKR0    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
92-129ILEPRARKAKLAKKRRNQKRNQRRNERKGHRKPNGKKPBasic
NLS Segment(s)
PositionSequence
95-129PRARKAKLAKKRRNQKRNQRRNERKGHRKPNGKKP
Subcellular Location(s) mito 15, nucl 10.5, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MFGQKGSDGCKCYKTGACNCGTGCLCSDLRGKCAAKTPRDNSNYEALCKELGEAEANAIWAQARGDANGAPADPPGPGNGNTLPPTPREPEILEPRARKAKLAKKRRNQKRNQRRNERKGHRKPNGKKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.43
3 0.47
4 0.47
5 0.47
6 0.46
7 0.47
8 0.43
9 0.36
10 0.29
11 0.26
12 0.23
13 0.22
14 0.28
15 0.23
16 0.24
17 0.3
18 0.29
19 0.27
20 0.36
21 0.4
22 0.42
23 0.5
24 0.52
25 0.54
26 0.58
27 0.58
28 0.52
29 0.53
30 0.46
31 0.38
32 0.35
33 0.26
34 0.22
35 0.2
36 0.17
37 0.09
38 0.08
39 0.08
40 0.07
41 0.07
42 0.07
43 0.07
44 0.07
45 0.06
46 0.05
47 0.04
48 0.04
49 0.06
50 0.06
51 0.06
52 0.06
53 0.07
54 0.07
55 0.07
56 0.07
57 0.05
58 0.05
59 0.06
60 0.05
61 0.05
62 0.05
63 0.07
64 0.08
65 0.1
66 0.11
67 0.14
68 0.15
69 0.17
70 0.17
71 0.17
72 0.19
73 0.2
74 0.2
75 0.2
76 0.21
77 0.27
78 0.35
79 0.38
80 0.41
81 0.4
82 0.44
83 0.5
84 0.48
85 0.44
86 0.45
87 0.5
88 0.54
89 0.64
90 0.69
91 0.72
92 0.83
93 0.9
94 0.91
95 0.92
96 0.93
97 0.94
98 0.94
99 0.95
100 0.96
101 0.96
102 0.95
103 0.96
104 0.95
105 0.95
106 0.95
107 0.95
108 0.94
109 0.94