Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S8AEE1

Protein Details
Accession S8AEE1    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
106-134YKGSSAPPRAEHKRKKRRWDGSHHVKDGEBasic
NLS Segment(s)
PositionSequence
113-123PRAEHKRKKRR
Subcellular Location(s) nucl 10.5, cyto_nucl 10.5, cyto 9.5, mito 4
Family & Domain DBs
Amino Acid Sequences MPDQINISIINKTGDRFFLKKWDPPNHSGKWLEGVDGSAVSPEDSANGWVKSAGELLYTVGSLSSDRKFKVSWDMNGEGEYEDDGADIKCDHYFLSHNEVLYFVLYKGSSAPPRAEHKRKKRRWDGSHHVKDGEGFNYEDFGYDFKFFESY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.24
3 0.25
4 0.26
5 0.34
6 0.37
7 0.41
8 0.49
9 0.55
10 0.56
11 0.59
12 0.65
13 0.59
14 0.61
15 0.57
16 0.48
17 0.45
18 0.38
19 0.33
20 0.24
21 0.21
22 0.16
23 0.14
24 0.13
25 0.07
26 0.07
27 0.06
28 0.06
29 0.05
30 0.05
31 0.05
32 0.08
33 0.1
34 0.1
35 0.1
36 0.1
37 0.1
38 0.1
39 0.1
40 0.08
41 0.06
42 0.06
43 0.06
44 0.06
45 0.06
46 0.05
47 0.04
48 0.05
49 0.05
50 0.07
51 0.09
52 0.11
53 0.12
54 0.13
55 0.13
56 0.14
57 0.24
58 0.25
59 0.26
60 0.29
61 0.3
62 0.29
63 0.29
64 0.29
65 0.19
66 0.15
67 0.12
68 0.07
69 0.05
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.05
76 0.05
77 0.05
78 0.05
79 0.06
80 0.08
81 0.1
82 0.18
83 0.18
84 0.18
85 0.18
86 0.19
87 0.18
88 0.16
89 0.15
90 0.07
91 0.08
92 0.07
93 0.08
94 0.09
95 0.13
96 0.16
97 0.17
98 0.19
99 0.23
100 0.31
101 0.41
102 0.5
103 0.56
104 0.65
105 0.74
106 0.81
107 0.88
108 0.9
109 0.91
110 0.9
111 0.9
112 0.9
113 0.9
114 0.91
115 0.83
116 0.73
117 0.62
118 0.56
119 0.48
120 0.39
121 0.3
122 0.21
123 0.17
124 0.18
125 0.18
126 0.15
127 0.13
128 0.12
129 0.12
130 0.13
131 0.13