Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8BB99

Protein Details
Accession S8BB99    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
32-53QVDPLLPNKKKKRKASEEDSDEHydrophilic
NLS Segment(s)
PositionSequence
40-45KKKKRK
Subcellular Location(s) nucl 18, cyto_nucl 13.5, cyto 7
Family & Domain DBs
Amino Acid Sequences DVIDVLSCLSVDGNIILQPTRWSKATEDTRKQVDPLLPNKKKKRKASEEDSDEDMTLEERQALERAETILSRISGIVPADA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.07
4 0.08
5 0.11
6 0.14
7 0.17
8 0.17
9 0.18
10 0.2
11 0.29
12 0.39
13 0.45
14 0.49
15 0.51
16 0.54
17 0.53
18 0.51
19 0.45
20 0.39
21 0.35
22 0.37
23 0.43
24 0.46
25 0.54
26 0.64
27 0.69
28 0.74
29 0.77
30 0.79
31 0.78
32 0.81
33 0.81
34 0.81
35 0.78
36 0.72
37 0.66
38 0.56
39 0.46
40 0.37
41 0.28
42 0.19
43 0.13
44 0.1
45 0.07
46 0.06
47 0.07
48 0.09
49 0.09
50 0.09
51 0.1
52 0.11
53 0.12
54 0.12
55 0.12
56 0.13
57 0.13
58 0.13
59 0.12
60 0.11
61 0.13