Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8BYU8

Protein Details
Accession S8BYU8   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
8-36FSSRKIYPGKEVSKKRTRRTVKHQRAIVGHydrophilic
NLS Segment(s)
PositionSequence
17-33KEVSKKRTRRTVKHQRA
42-109IKEKRSIAPAARAAARAQAVKEGKEKKAAAESKKKAEKAKSAATAARGQAGKVSKQGAKGAPQKVQAR
Subcellular Location(s) nucl 18.5, mito_nucl 13.5, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000988  Ribosomal_L24e-rel  
Amino Acid Sequences MKVELDSFSSRKIYPGKEVSKKRTRRTVKHQRAIVGASLDVIKEKRSIAPAARAAARAQAVKEGKEKKAAAESKKKAEKAKSAATAARGQAGKVSKQGAKGAPQKVQARTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.43
3 0.5
4 0.56
5 0.65
6 0.7
7 0.74
8 0.8
9 0.8
10 0.81
11 0.82
12 0.82
13 0.84
14 0.86
15 0.87
16 0.86
17 0.82
18 0.74
19 0.67
20 0.59
21 0.5
22 0.39
23 0.27
24 0.19
25 0.15
26 0.12
27 0.1
28 0.09
29 0.08
30 0.08
31 0.09
32 0.1
33 0.12
34 0.14
35 0.15
36 0.2
37 0.22
38 0.22
39 0.23
40 0.22
41 0.19
42 0.19
43 0.18
44 0.13
45 0.11
46 0.15
47 0.15
48 0.16
49 0.23
50 0.25
51 0.25
52 0.31
53 0.31
54 0.26
55 0.34
56 0.39
57 0.4
58 0.46
59 0.5
60 0.53
61 0.59
62 0.62
63 0.59
64 0.59
65 0.6
66 0.56
67 0.59
68 0.55
69 0.52
70 0.5
71 0.47
72 0.45
73 0.37
74 0.36
75 0.29
76 0.24
77 0.25
78 0.26
79 0.25
80 0.24
81 0.28
82 0.25
83 0.28
84 0.34
85 0.33
86 0.38
87 0.45
88 0.47
89 0.48
90 0.54
91 0.57