Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8AKW5

Protein Details
Accession S8AKW5    Localization Confidence High Confidence Score 19
NoLS Segment(s)
PositionSequenceProtein Nature
7-38LGFELRSRHKTSQKKPGRIRRIQNRDRIIKSPHydrophilic
263-287LLKLENPEKKKRARSLAKAKLPGKDHydrophilic
292-314AEDIGAKPPVKPRPKRKKGSKPVBasic
NLS Segment(s)
PositionSequence
14-28RHKTSQKKPGRIRRI
269-314PEKKKRARSLAKAKLPGKDMKLVAEDIGAKPPVKPRPKRKKGSKPV
Subcellular Location(s) nucl 13.5, mito 13, cyto_nucl 7.5
Family & Domain DBs
Amino Acid Sequences MVTVPPLGFELRSRHKTSQKKPGRIRRIQNRDRIIKSPVITNLKEKYSKYPQWYAVTKLPPKSADPGGYMNLLNRPAECRDYANVLGIKPWVIRHIKAALRRCYWKHPGILQLNYKNHEHRDRLAEEINIGIRNYATTITQELRSGNMSNKVLEKKENEYAAFMALSDCVYKLGSYQVSGYLLYKLAESIMKEMIKEKRENMEKVHMLRKEVSRARDFVRSEKQSLKPVKQEESKNGSSAVGESKKSKIVTLKVSPEKLQALLLKLENPEKKKRARSLAKAKLPGKDMKLVAEDIGAKPPVKPRPKRKKGSKPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.59
3 0.69
4 0.75
5 0.77
6 0.78
7 0.82
8 0.86
9 0.89
10 0.91
11 0.9
12 0.92
13 0.92
14 0.92
15 0.9
16 0.9
17 0.88
18 0.87
19 0.82
20 0.75
21 0.69
22 0.63
23 0.56
24 0.52
25 0.5
26 0.48
27 0.45
28 0.47
29 0.47
30 0.47
31 0.5
32 0.46
33 0.47
34 0.5
35 0.55
36 0.56
37 0.59
38 0.59
39 0.62
40 0.63
41 0.6
42 0.58
43 0.59
44 0.58
45 0.54
46 0.52
47 0.47
48 0.46
49 0.45
50 0.42
51 0.35
52 0.33
53 0.31
54 0.29
55 0.28
56 0.26
57 0.22
58 0.22
59 0.2
60 0.18
61 0.15
62 0.17
63 0.18
64 0.2
65 0.2
66 0.19
67 0.2
68 0.24
69 0.24
70 0.26
71 0.25
72 0.22
73 0.22
74 0.19
75 0.18
76 0.15
77 0.15
78 0.16
79 0.17
80 0.18
81 0.21
82 0.27
83 0.3
84 0.37
85 0.45
86 0.45
87 0.48
88 0.54
89 0.53
90 0.54
91 0.57
92 0.55
93 0.51
94 0.47
95 0.51
96 0.51
97 0.53
98 0.52
99 0.53
100 0.52
101 0.5
102 0.48
103 0.42
104 0.42
105 0.42
106 0.38
107 0.34
108 0.37
109 0.35
110 0.36
111 0.35
112 0.3
113 0.24
114 0.22
115 0.2
116 0.14
117 0.13
118 0.09
119 0.07
120 0.07
121 0.07
122 0.07
123 0.06
124 0.06
125 0.08
126 0.09
127 0.1
128 0.11
129 0.11
130 0.11
131 0.12
132 0.13
133 0.13
134 0.16
135 0.16
136 0.16
137 0.2
138 0.22
139 0.21
140 0.23
141 0.24
142 0.23
143 0.26
144 0.27
145 0.23
146 0.21
147 0.2
148 0.18
149 0.15
150 0.11
151 0.07
152 0.05
153 0.05
154 0.05
155 0.04
156 0.04
157 0.04
158 0.04
159 0.05
160 0.07
161 0.07
162 0.08
163 0.08
164 0.09
165 0.09
166 0.1
167 0.1
168 0.08
169 0.08
170 0.08
171 0.08
172 0.07
173 0.07
174 0.08
175 0.07
176 0.08
177 0.11
178 0.11
179 0.12
180 0.17
181 0.22
182 0.25
183 0.26
184 0.27
185 0.32
186 0.38
187 0.4
188 0.39
189 0.42
190 0.42
191 0.44
192 0.48
193 0.41
194 0.38
195 0.4
196 0.39
197 0.4
198 0.4
199 0.42
200 0.38
201 0.4
202 0.4
203 0.43
204 0.42
205 0.4
206 0.45
207 0.43
208 0.44
209 0.48
210 0.49
211 0.51
212 0.57
213 0.55
214 0.53
215 0.54
216 0.57
217 0.57
218 0.58
219 0.58
220 0.59
221 0.55
222 0.49
223 0.45
224 0.38
225 0.3
226 0.27
227 0.25
228 0.21
229 0.21
230 0.22
231 0.24
232 0.28
233 0.28
234 0.3
235 0.29
236 0.31
237 0.38
238 0.43
239 0.5
240 0.53
241 0.55
242 0.54
243 0.51
244 0.47
245 0.39
246 0.36
247 0.29
248 0.25
249 0.25
250 0.25
251 0.24
252 0.24
253 0.31
254 0.34
255 0.37
256 0.45
257 0.49
258 0.56
259 0.63
260 0.7
261 0.73
262 0.77
263 0.82
264 0.83
265 0.86
266 0.87
267 0.87
268 0.82
269 0.77
270 0.71
271 0.67
272 0.6
273 0.57
274 0.49
275 0.43
276 0.42
277 0.37
278 0.32
279 0.28
280 0.26
281 0.2
282 0.24
283 0.23
284 0.2
285 0.22
286 0.3
287 0.37
288 0.45
289 0.54
290 0.61
291 0.7
292 0.81
293 0.89
294 0.93