Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8C1R8

Protein Details
Accession S8C1R8    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
46-68EQERNAYRRKKLDREFERKREEIBasic
150-170DPSTHKKKKIPSFLRHEKPSPBasic
NLS Segment(s)
PositionSequence
155-168KKKKIPSFLRHEKP
Subcellular Location(s) nucl 22.5, cyto_nucl 15, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MDLDPAEDQYPEHYYTYDLVGKDTVYTAYPSVVLQNMTNMSTSLREQERNAYRRKKLDREFERKREEIIKFHAEFTRVLDEIKSLFLIQSVSTTGFTAGEAEIQRQNLGETTEFDAYQTRSTNVNPHMVSGLPGSVAPMSAKMKVNENIDPSTHKKKKIPSFLRHEKPSPPHSPEPTTPRRQGRFGVSAMNRNSGRNTRSSGSRRPRTIPAERLALLDIEESDVRRRLNFT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.22
4 0.23
5 0.19
6 0.19
7 0.19
8 0.18
9 0.18
10 0.17
11 0.14
12 0.1
13 0.12
14 0.11
15 0.11
16 0.11
17 0.11
18 0.12
19 0.13
20 0.13
21 0.11
22 0.14
23 0.15
24 0.15
25 0.15
26 0.13
27 0.12
28 0.13
29 0.14
30 0.17
31 0.19
32 0.21
33 0.22
34 0.31
35 0.4
36 0.44
37 0.53
38 0.55
39 0.58
40 0.66
41 0.73
42 0.74
43 0.72
44 0.77
45 0.78
46 0.8
47 0.84
48 0.84
49 0.83
50 0.73
51 0.69
52 0.66
53 0.58
54 0.52
55 0.48
56 0.47
57 0.4
58 0.42
59 0.41
60 0.34
61 0.31
62 0.29
63 0.26
64 0.19
65 0.18
66 0.15
67 0.14
68 0.13
69 0.13
70 0.1
71 0.06
72 0.06
73 0.06
74 0.07
75 0.06
76 0.06
77 0.07
78 0.07
79 0.07
80 0.08
81 0.07
82 0.07
83 0.07
84 0.07
85 0.06
86 0.08
87 0.07
88 0.09
89 0.1
90 0.1
91 0.11
92 0.1
93 0.1
94 0.08
95 0.09
96 0.08
97 0.08
98 0.1
99 0.11
100 0.11
101 0.11
102 0.12
103 0.12
104 0.13
105 0.12
106 0.1
107 0.11
108 0.12
109 0.17
110 0.17
111 0.22
112 0.2
113 0.2
114 0.2
115 0.18
116 0.18
117 0.13
118 0.11
119 0.06
120 0.06
121 0.06
122 0.05
123 0.05
124 0.04
125 0.07
126 0.08
127 0.11
128 0.14
129 0.14
130 0.19
131 0.23
132 0.26
133 0.26
134 0.28
135 0.26
136 0.25
137 0.29
138 0.3
139 0.37
140 0.39
141 0.41
142 0.42
143 0.5
144 0.59
145 0.65
146 0.7
147 0.68
148 0.74
149 0.8
150 0.83
151 0.8
152 0.74
153 0.7
154 0.67
155 0.66
156 0.63
157 0.6
158 0.58
159 0.58
160 0.6
161 0.59
162 0.61
163 0.62
164 0.63
165 0.63
166 0.66
167 0.65
168 0.62
169 0.6
170 0.58
171 0.54
172 0.47
173 0.48
174 0.42
175 0.46
176 0.44
177 0.47
178 0.41
179 0.37
180 0.41
181 0.38
182 0.38
183 0.34
184 0.37
185 0.34
186 0.42
187 0.47
188 0.53
189 0.58
190 0.64
191 0.66
192 0.66
193 0.71
194 0.7
195 0.73
196 0.7
197 0.64
198 0.61
199 0.56
200 0.52
201 0.45
202 0.37
203 0.28
204 0.21
205 0.16
206 0.13
207 0.13
208 0.13
209 0.16
210 0.2
211 0.2