FuNGI

S8CC04

Protein Details

Accession

S8CC04

Localization Confidence

Medium

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
398-421	ATWIRNFVRKHPKYEKDSKVNSEI	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 19.5, cyto_nucl 14, cyto 5.5

Family & Domain DBs

InterPro	View protein in InterPro IPR004308 GCS IPR014746 Gln_synth/guanido_kin_cat_dom
Gene Ontology	GO:0005524 F:ATP binding GO:0004357 F:glutamate-cysteine ligase activity GO:0006750 P:glutathione biosynthetic process
Pfam	View protein in Pfam PF03074 GCS

Amino Acid Sequences

MPIFYDEKTPQPFNDPTVLYDLSDYPEDEDVRKGAAKTGHVYMDAMGFGMGSCCLQITFQAKNISEARTLYDQLCPLGPIMLALSAASPIFKGYLTDIDCRWNVISAAVDDRTEEERGLKPLSEDKYLIPKSRYDSVSTYISQDPGFRQEYNDVNIHQNPILKQKLLDGGMDEMLARHFAHLFIRDPLVVFSESVKNFNINENDNFENIQSTNWQHMRFKPPPSSEDTIGWRVEFRSMEVQLTDFENAAFSIFIVLLTRTILSYGLNFYIPISKVTENMETAHRRNAVLCEKFYFRKHVFPHRYSSRNGKGVLNPTHDQSASNTPKFPEPGPVEDEYCLMTISEIMNGQSSPNGFPGLISLIESYLNSVNVDVETRCELARYLDLIKKRSNGTWETAATWIRNFVRKHPKYEKDSKVNSEINYDLIKAAENLGNSDGKGTDLRKGLFEQRQL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.44
2	0.38
3	0.33
4	0.36
5	0.35
6	0.28
7	0.28
8	0.25
9	0.21
10	0.21
11	0.19
12	0.16
13	0.19
14	0.2
15	0.19
16	0.2
17	0.18
18	0.19
19	0.22
20	0.2
21	0.22
22	0.24
23	0.27
24	0.28
25	0.32
26	0.31
27	0.29
28	0.29
29	0.24
30	0.21
31	0.18
32	0.14
33	0.09
34	0.07
35	0.07
36	0.07
37	0.06
38	0.05
39	0.05
40	0.05
41	0.05
42	0.05
43	0.1
44	0.14
45	0.16
46	0.22
47	0.28
48	0.29
49	0.34
50	0.37
51	0.35
52	0.33
53	0.31
54	0.3
55	0.27
56	0.29
57	0.24
58	0.25
59	0.23
60	0.22
61	0.22
62	0.18
63	0.15
64	0.13
65	0.12
66	0.09
67	0.08
68	0.07
69	0.07
70	0.06
71	0.06
72	0.05
73	0.06
74	0.05
75	0.05
76	0.05
77	0.06
78	0.06
79	0.06
80	0.07
81	0.14
82	0.16
83	0.19
84	0.2
85	0.24
86	0.24
87	0.25
88	0.24
89	0.19
90	0.16
91	0.14
92	0.15
93	0.11
94	0.15
95	0.14
96	0.13
97	0.12
98	0.14
99	0.16
100	0.15
101	0.14
102	0.14
103	0.16
104	0.19
105	0.2
106	0.18
107	0.17
108	0.23
109	0.26
110	0.25
111	0.24
112	0.23
113	0.32
114	0.35
115	0.37
116	0.33
117	0.33
118	0.34
119	0.4
120	0.4
121	0.34
122	0.33
123	0.32
124	0.35
125	0.32
126	0.32
127	0.25
128	0.25
129	0.22
130	0.21
131	0.18
132	0.19
133	0.21
134	0.18
135	0.19
136	0.22
137	0.24
138	0.26
139	0.26
140	0.23
141	0.24
142	0.25
143	0.25
144	0.22
145	0.22
146	0.21
147	0.26
148	0.26
149	0.22
150	0.22
151	0.22
152	0.25
153	0.23
154	0.22
155	0.16
156	0.15
157	0.15
158	0.14
159	0.12
160	0.07
161	0.06
162	0.07
163	0.06
164	0.05
165	0.05
166	0.06
167	0.08
168	0.1
169	0.11
170	0.12
171	0.13
172	0.12
173	0.12
174	0.12
175	0.12
176	0.1
177	0.09
178	0.1
179	0.15
180	0.15
181	0.16
182	0.16
183	0.15
184	0.16
185	0.2
186	0.2
187	0.18
188	0.19
189	0.21
190	0.22
191	0.21
192	0.21
193	0.16
194	0.15
195	0.12
196	0.11
197	0.09
198	0.09
199	0.14
200	0.17
201	0.19
202	0.2
203	0.24
204	0.33
205	0.36
206	0.4
207	0.41
208	0.41
209	0.41
210	0.45
211	0.44
212	0.37
213	0.35
214	0.34
215	0.3
216	0.28
217	0.25
218	0.19
219	0.16
220	0.17
221	0.14
222	0.12
223	0.13
224	0.13
225	0.13
226	0.13
227	0.13
228	0.12
229	0.13
230	0.11
231	0.07
232	0.07
233	0.06
234	0.06
235	0.06
236	0.05
237	0.04
238	0.04
239	0.04
240	0.04
241	0.04
242	0.04
243	0.04
244	0.04
245	0.05
246	0.04
247	0.05
248	0.05
249	0.05
250	0.05
251	0.06
252	0.07
253	0.07
254	0.07
255	0.07
256	0.11
257	0.11
258	0.11
259	0.13
260	0.13
261	0.14
262	0.17
263	0.18
264	0.15
265	0.16
266	0.21
267	0.22
268	0.23
269	0.27
270	0.25
271	0.24
272	0.24
273	0.29
274	0.31
275	0.3
276	0.3
277	0.28
278	0.31
279	0.34
280	0.35
281	0.37
282	0.31
283	0.36
284	0.4
285	0.48
286	0.54
287	0.53
288	0.6
289	0.6
290	0.62
291	0.58
292	0.62
293	0.59
294	0.55
295	0.54
296	0.48
297	0.46
298	0.5
299	0.52
300	0.48
301	0.42
302	0.38
303	0.39
304	0.35
305	0.31
306	0.26
307	0.3
308	0.32
309	0.32
310	0.32
311	0.31
312	0.34
313	0.36
314	0.33
315	0.31
316	0.28
317	0.3
318	0.32
319	0.33
320	0.31
321	0.3
322	0.29
323	0.21
324	0.18
325	0.14
326	0.1
327	0.08
328	0.07
329	0.07
330	0.08
331	0.07
332	0.07
333	0.08
334	0.08
335	0.09
336	0.09
337	0.1
338	0.1
339	0.11
340	0.11
341	0.1
342	0.1
343	0.11
344	0.11
345	0.1
346	0.1
347	0.09
348	0.09
349	0.09
350	0.09
351	0.1
352	0.1
353	0.1
354	0.09
355	0.09
356	0.09
357	0.09
358	0.11
359	0.09
360	0.1
361	0.12
362	0.13
363	0.13
364	0.13
365	0.13
366	0.14
367	0.16
368	0.17
369	0.2
370	0.23
371	0.28
372	0.32
373	0.36
374	0.38
375	0.39
376	0.4
377	0.41
378	0.41
379	0.41
380	0.43
381	0.4
382	0.37
383	0.38
384	0.37
385	0.31
386	0.28
387	0.29
388	0.27
389	0.32
390	0.32
391	0.38
392	0.47
393	0.51
394	0.6
395	0.65
396	0.7
397	0.73
398	0.82
399	0.82
400	0.81
401	0.84
402	0.81
403	0.79
404	0.74
405	0.66
406	0.6
407	0.51
408	0.43
409	0.37
410	0.31
411	0.23
412	0.18
413	0.18
414	0.13
415	0.16
416	0.15
417	0.14
418	0.15
419	0.17
420	0.18
421	0.17
422	0.18
423	0.15
424	0.15
425	0.19
426	0.18
427	0.22
428	0.26
429	0.28
430	0.29
431	0.33
432	0.41

S8CC04

3D AlphaFold-predicted Structure Viewer