Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8A7Y7

Protein Details
Accession S8A7Y7   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
68-98VEEHKLRGKGKPKKYKLGRERTAGKNKKKRKBasic
NLS Segment(s)
PositionSequence
72-98KLRGKGKPKKYKLGRERTAGKNKKKRK
Subcellular Location(s) mito 16, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MRVSCRIFNTTFNPNGERTGNKILRERLKGPTLLEYYPKEQFSMREFVRGFPDLGISDEKEEYRVQQVEEHKLRGKGKPKKYKLGRERTAGKNKKKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.38
3 0.36
4 0.33
5 0.31
6 0.36
7 0.37
8 0.38
9 0.42
10 0.46
11 0.51
12 0.55
13 0.52
14 0.48
15 0.48
16 0.46
17 0.41
18 0.4
19 0.35
20 0.3
21 0.31
22 0.28
23 0.27
24 0.29
25 0.28
26 0.23
27 0.21
28 0.22
29 0.21
30 0.25
31 0.22
32 0.24
33 0.24
34 0.24
35 0.27
36 0.26
37 0.23
38 0.16
39 0.17
40 0.11
41 0.13
42 0.12
43 0.09
44 0.1
45 0.1
46 0.1
47 0.11
48 0.11
49 0.11
50 0.14
51 0.15
52 0.15
53 0.19
54 0.23
55 0.31
56 0.34
57 0.37
58 0.36
59 0.41
60 0.43
61 0.45
62 0.52
63 0.52
64 0.6
65 0.67
66 0.71
67 0.76
68 0.83
69 0.87
70 0.87
71 0.89
72 0.85
73 0.83
74 0.84
75 0.83
76 0.84
77 0.83
78 0.84