Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8ARD3

Protein Details
Accession S8ARD3    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
51-78LKPLIGWKKWRYKRKTKRPKALQNSLALHydrophilic
NLS Segment(s)
PositionSequence
57-71WKKWRYKRKTKRPKA
Subcellular Location(s) nucl 15.5, mito_nucl 9.5, cyto 3, pero 3, cyto_pero 3
Family & Domain DBs
Amino Acid Sequences MVFNNLPNSYDTGSAAYTEGQEDSRKSQGIRTETTGTNPETDHDSIRQSLLKPLIGWKKWRYKRKTKRPKALQNSLALRQKYDRIKRLQRETEASILLHNLARLDGKKSKTLEFANVGLGQYDVLWPSVYGRPDQKVWMRIAEYQRKGSTIMIKRDGYPLSRYTTELFSMFW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.12
4 0.11
5 0.11
6 0.11
7 0.11
8 0.13
9 0.15
10 0.18
11 0.21
12 0.23
13 0.22
14 0.25
15 0.31
16 0.33
17 0.35
18 0.36
19 0.37
20 0.36
21 0.39
22 0.38
23 0.32
24 0.29
25 0.25
26 0.21
27 0.21
28 0.21
29 0.2
30 0.18
31 0.19
32 0.19
33 0.2
34 0.22
35 0.18
36 0.21
37 0.21
38 0.21
39 0.19
40 0.25
41 0.32
42 0.32
43 0.38
44 0.41
45 0.49
46 0.57
47 0.66
48 0.68
49 0.71
50 0.8
51 0.85
52 0.89
53 0.89
54 0.92
55 0.93
56 0.94
57 0.93
58 0.91
59 0.84
60 0.8
61 0.73
62 0.68
63 0.63
64 0.52
65 0.43
66 0.35
67 0.36
68 0.37
69 0.4
70 0.4
71 0.43
72 0.51
73 0.58
74 0.65
75 0.64
76 0.59
77 0.57
78 0.52
79 0.46
80 0.38
81 0.31
82 0.23
83 0.17
84 0.15
85 0.11
86 0.09
87 0.06
88 0.06
89 0.07
90 0.08
91 0.12
92 0.17
93 0.19
94 0.24
95 0.26
96 0.28
97 0.31
98 0.32
99 0.32
100 0.29
101 0.28
102 0.25
103 0.24
104 0.22
105 0.17
106 0.15
107 0.11
108 0.08
109 0.08
110 0.06
111 0.05
112 0.05
113 0.05
114 0.08
115 0.12
116 0.13
117 0.15
118 0.19
119 0.22
120 0.23
121 0.29
122 0.32
123 0.34
124 0.35
125 0.36
126 0.35
127 0.38
128 0.46
129 0.5
130 0.49
131 0.5
132 0.49
133 0.45
134 0.44
135 0.41
136 0.42
137 0.4
138 0.44
139 0.45
140 0.45
141 0.46
142 0.49
143 0.49
144 0.42
145 0.38
146 0.33
147 0.33
148 0.33
149 0.33
150 0.31
151 0.31
152 0.3