Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RY22

Protein Details
Accession F4RY22   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
3-28AAVTKTCPKLTKRKLCRILNPANLKFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, cyto_mito 12.833, cyto_nucl 3.333, cyto 3
Family & Domain DBs
KEGG mlr:MELLADRAFT_91166  -  
Amino Acid Sequences MVAAVTKTCPKLTKRKLCRILNPANLKFSLNLTLPLLHSLHPPASDPFKSKSPIHPSIVYSFKPSAIKSYFGTTLMVPSIFFNYSTIRYKIDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.74
3 0.81
4 0.84
5 0.87
6 0.85
7 0.84
8 0.83
9 0.82
10 0.73
11 0.66
12 0.59
13 0.5
14 0.41
15 0.33
16 0.27
17 0.18
18 0.17
19 0.14
20 0.15
21 0.14
22 0.15
23 0.14
24 0.11
25 0.11
26 0.11
27 0.11
28 0.1
29 0.11
30 0.11
31 0.15
32 0.15
33 0.17
34 0.19
35 0.21
36 0.25
37 0.25
38 0.31
39 0.36
40 0.4
41 0.41
42 0.41
43 0.39
44 0.4
45 0.43
46 0.35
47 0.31
48 0.26
49 0.25
50 0.25
51 0.23
52 0.25
53 0.23
54 0.25
55 0.23
56 0.26
57 0.25
58 0.23
59 0.24
60 0.18
61 0.18
62 0.16
63 0.15
64 0.11
65 0.11
66 0.13
67 0.12
68 0.13
69 0.12
70 0.14
71 0.19
72 0.24
73 0.25