Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8AQP9

Protein Details
Accession S8AQP9    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
144-165GQRPGQQRQRPGPQNNNQRFNPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito 11, cyto_nucl 8, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024079  MetalloPept_cat_dom_sf  
IPR001818  Pept_M10_metallopeptidase  
IPR021190  Pept_M10A  
Gene Ontology GO:0031012  C:extracellular matrix  
GO:0004222  F:metalloendopeptidase activity  
GO:0008270  F:zinc ion binding  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF00413  Peptidase_M10  
Amino Acid Sequences MEAAFEKAQKKWAQHITFKFQKATTGAPNLFIHVVGPNDYPFLQNPGAQGRANIGPAGPITAPSNIYFKGPGTTWGPGAIHTLFLHEFGHVLGLHHSNNQGAIMAPSIQGMFSERQLTAVDSKRAQIIASGGNPNTSEYMLMEGQRPGQQRQRPGPQNNNQRFNPAQRQRPGPQYNQRFNQAQRPQYNRFNPVRQQQPFSTRGRAQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.64
3 0.67
4 0.7
5 0.71
6 0.65
7 0.55
8 0.52
9 0.46
10 0.43
11 0.4
12 0.4
13 0.36
14 0.37
15 0.37
16 0.34
17 0.32
18 0.27
19 0.21
20 0.15
21 0.15
22 0.13
23 0.13
24 0.12
25 0.13
26 0.14
27 0.14
28 0.13
29 0.17
30 0.16
31 0.16
32 0.18
33 0.2
34 0.23
35 0.21
36 0.21
37 0.19
38 0.19
39 0.19
40 0.17
41 0.13
42 0.11
43 0.1
44 0.12
45 0.09
46 0.08
47 0.09
48 0.1
49 0.11
50 0.12
51 0.14
52 0.12
53 0.13
54 0.13
55 0.12
56 0.13
57 0.12
58 0.13
59 0.14
60 0.15
61 0.14
62 0.15
63 0.15
64 0.13
65 0.16
66 0.13
67 0.11
68 0.1
69 0.11
70 0.1
71 0.11
72 0.1
73 0.08
74 0.08
75 0.06
76 0.08
77 0.06
78 0.06
79 0.07
80 0.08
81 0.09
82 0.1
83 0.1
84 0.09
85 0.09
86 0.08
87 0.07
88 0.05
89 0.05
90 0.05
91 0.05
92 0.05
93 0.05
94 0.05
95 0.04
96 0.04
97 0.06
98 0.06
99 0.07
100 0.09
101 0.08
102 0.09
103 0.1
104 0.11
105 0.14
106 0.17
107 0.19
108 0.18
109 0.18
110 0.18
111 0.18
112 0.17
113 0.13
114 0.11
115 0.11
116 0.13
117 0.15
118 0.14
119 0.15
120 0.15
121 0.15
122 0.14
123 0.11
124 0.09
125 0.07
126 0.1
127 0.1
128 0.11
129 0.11
130 0.11
131 0.13
132 0.17
133 0.19
134 0.2
135 0.28
136 0.32
137 0.38
138 0.46
139 0.55
140 0.6
141 0.66
142 0.73
143 0.74
144 0.81
145 0.82
146 0.81
147 0.71
148 0.68
149 0.63
150 0.61
151 0.62
152 0.59
153 0.59
154 0.58
155 0.65
156 0.64
157 0.71
158 0.69
159 0.68
160 0.7
161 0.71
162 0.74
163 0.72
164 0.73
165 0.68
166 0.65
167 0.66
168 0.64
169 0.63
170 0.63
171 0.65
172 0.66
173 0.7
174 0.74
175 0.72
176 0.71
177 0.7
178 0.69
179 0.71
180 0.75
181 0.7
182 0.69
183 0.67
184 0.67
185 0.66
186 0.63
187 0.62