Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4S7D4

Protein Details
Accession F4S7D4   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
25-47IEDVKIPRPKKNQKGRIHSKASEHydrophilic
NLS Segment(s)
PositionSequence
32-40RPKKNQKGR
Subcellular Location(s) nucl 14.5, cyto 11, mito_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
KEGG mlr:MELLADRAFT_31912  -  
CDD cd12232  RRM3_U2AF65  
Amino Acid Sequences ELVDDEEYKEILEDIIEECSKYVKIEDVKIPRPKKNQKGRIHSKASESVEGLGKVFIKFEQIEDCGQALSAIAGRQFAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.1
3 0.1
4 0.1
5 0.09
6 0.11
7 0.11
8 0.11
9 0.11
10 0.12
11 0.15
12 0.19
13 0.26
14 0.32
15 0.4
16 0.48
17 0.53
18 0.54
19 0.61
20 0.67
21 0.7
22 0.74
23 0.77
24 0.77
25 0.83
26 0.86
27 0.84
28 0.81
29 0.73
30 0.65
31 0.62
32 0.55
33 0.46
34 0.36
35 0.29
36 0.24
37 0.22
38 0.19
39 0.13
40 0.12
41 0.1
42 0.1
43 0.09
44 0.1
45 0.1
46 0.11
47 0.14
48 0.15
49 0.16
50 0.17
51 0.17
52 0.14
53 0.13
54 0.12
55 0.08
56 0.07
57 0.08
58 0.07
59 0.08