Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8BSZ2

Protein Details
Accession S8BSZ2    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
90-109QKLAAQKKKQYGKSKPTLLKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 13.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007727  Spo12  
Pfam View protein in Pfam  
PF05032  Spo12  
Amino Acid Sequences MSSFPLSEVPVNEAGMSTPMTSQELEETSIPTTSESSPLASVEPLHQLQGTPADNLEAQRKLLQQKLTEHAANAEKFNSPTDSMMSPCSQKLAAQKKKQYGKSKPTLLKSAFAQVAGQENRAPRKRADDDSPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.13
4 0.09
5 0.08
6 0.09
7 0.1
8 0.1
9 0.1
10 0.12
11 0.12
12 0.13
13 0.13
14 0.13
15 0.13
16 0.13
17 0.13
18 0.11
19 0.12
20 0.11
21 0.12
22 0.12
23 0.12
24 0.12
25 0.12
26 0.12
27 0.1
28 0.1
29 0.09
30 0.13
31 0.12
32 0.12
33 0.11
34 0.11
35 0.11
36 0.15
37 0.15
38 0.11
39 0.11
40 0.11
41 0.11
42 0.13
43 0.16
44 0.12
45 0.11
46 0.13
47 0.16
48 0.18
49 0.22
50 0.23
51 0.23
52 0.26
53 0.28
54 0.29
55 0.27
56 0.24
57 0.23
58 0.24
59 0.22
60 0.19
61 0.17
62 0.14
63 0.14
64 0.16
65 0.14
66 0.11
67 0.11
68 0.13
69 0.13
70 0.13
71 0.14
72 0.15
73 0.14
74 0.13
75 0.14
76 0.12
77 0.14
78 0.22
79 0.31
80 0.39
81 0.47
82 0.54
83 0.61
84 0.7
85 0.77
86 0.78
87 0.77
88 0.78
89 0.78
90 0.81
91 0.79
92 0.76
93 0.75
94 0.67
95 0.61
96 0.52
97 0.5
98 0.41
99 0.34
100 0.29
101 0.22
102 0.29
103 0.26
104 0.25
105 0.21
106 0.26
107 0.35
108 0.41
109 0.43
110 0.37
111 0.46
112 0.51
113 0.55