Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4R3R1

Protein Details
Accession F4R3R1   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MPKEKKKLKIKIKIITFNKRLSHydrophilic
197-220VLNPPKRKYKSSPFMIKHRSRYSSHydrophilic
NLS Segment(s)
PositionSequence
5-11KKKLKIK
Subcellular Location(s) mito 15, nucl 10.5, cyto_nucl 6.5
Family & Domain DBs
KEGG mlr:MELLADRAFT_101135  -  
Amino Acid Sequences MPKEKKKLKIKIKIITFNKRLSSRLTSLNSTFTFNSSSKSQSLYQPIQAEPSSTLDLLEIKNPINLDLRTLKPTAKPEVIDLINISIPINIHPKTDSINLNPFCPISKPSSKKILRRRFVSLPPKLTTIFEDQLKEKEEEERNTCFVEIKIINRSSTYTYHSIYEPSKTHKGSYRPGSEFIQLRGTPSKPYPHLTGVLNPPKRKYKSSPFMIKHRSRYSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.86
3 0.81
4 0.76
5 0.74
6 0.67
7 0.6
8 0.56
9 0.54
10 0.47
11 0.5
12 0.47
13 0.45
14 0.44
15 0.48
16 0.42
17 0.39
18 0.35
19 0.28
20 0.28
21 0.24
22 0.26
23 0.22
24 0.24
25 0.22
26 0.25
27 0.26
28 0.27
29 0.35
30 0.34
31 0.37
32 0.37
33 0.36
34 0.36
35 0.34
36 0.29
37 0.23
38 0.23
39 0.2
40 0.16
41 0.16
42 0.13
43 0.14
44 0.14
45 0.14
46 0.12
47 0.11
48 0.12
49 0.12
50 0.13
51 0.16
52 0.15
53 0.17
54 0.2
55 0.22
56 0.24
57 0.25
58 0.25
59 0.25
60 0.29
61 0.31
62 0.28
63 0.27
64 0.25
65 0.3
66 0.28
67 0.24
68 0.2
69 0.16
70 0.14
71 0.13
72 0.12
73 0.07
74 0.06
75 0.08
76 0.12
77 0.11
78 0.11
79 0.12
80 0.12
81 0.14
82 0.19
83 0.19
84 0.18
85 0.26
86 0.26
87 0.26
88 0.26
89 0.23
90 0.19
91 0.18
92 0.17
93 0.15
94 0.23
95 0.26
96 0.29
97 0.4
98 0.44
99 0.52
100 0.61
101 0.65
102 0.63
103 0.64
104 0.66
105 0.61
106 0.66
107 0.67
108 0.62
109 0.57
110 0.51
111 0.49
112 0.44
113 0.39
114 0.32
115 0.28
116 0.25
117 0.22
118 0.22
119 0.21
120 0.23
121 0.25
122 0.23
123 0.18
124 0.23
125 0.26
126 0.29
127 0.31
128 0.32
129 0.3
130 0.3
131 0.3
132 0.24
133 0.18
134 0.2
135 0.18
136 0.18
137 0.24
138 0.24
139 0.24
140 0.24
141 0.26
142 0.23
143 0.23
144 0.25
145 0.22
146 0.21
147 0.23
148 0.23
149 0.25
150 0.23
151 0.26
152 0.24
153 0.28
154 0.34
155 0.33
156 0.36
157 0.39
158 0.44
159 0.48
160 0.54
161 0.56
162 0.52
163 0.54
164 0.53
165 0.52
166 0.49
167 0.42
168 0.4
169 0.32
170 0.33
171 0.34
172 0.32
173 0.32
174 0.33
175 0.39
176 0.35
177 0.39
178 0.4
179 0.39
180 0.42
181 0.39
182 0.42
183 0.44
184 0.51
185 0.54
186 0.53
187 0.56
188 0.62
189 0.64
190 0.65
191 0.64
192 0.65
193 0.68
194 0.75
195 0.79
196 0.76
197 0.82
198 0.86
199 0.85
200 0.83