Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8AQP5

Protein Details
Accession S8AQP5    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
17-36KSGPGRKKKPTTPTEPTRRSBasic
NLS Segment(s)
PositionSequence
19-26GPGRKKKP
52-109KPKAAPKKRKTTVADKVVGVAKKVKGTLTKKPAVKAAGTKKIKGTDGKGVKKTKAKAV
Subcellular Location(s) nucl 14, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MAPTTNTTTTTTTAAAKSGPGRKKKPTTPTEPTRRSTRTITPRTIFSTGVTKPKAAPKKRKTTVADKVVGVAKKVKGTLTKKPAVKAAGTKKIKGTDGKGVKKTKAKAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.16
3 0.17
4 0.22
5 0.28
6 0.34
7 0.41
8 0.46
9 0.55
10 0.64
11 0.69
12 0.73
13 0.73
14 0.75
15 0.75
16 0.8
17 0.81
18 0.78
19 0.74
20 0.72
21 0.66
22 0.61
23 0.56
24 0.55
25 0.55
26 0.55
27 0.58
28 0.51
29 0.51
30 0.51
31 0.48
32 0.39
33 0.3
34 0.29
35 0.24
36 0.28
37 0.26
38 0.22
39 0.22
40 0.3
41 0.37
42 0.4
43 0.49
44 0.52
45 0.62
46 0.66
47 0.73
48 0.7
49 0.71
50 0.72
51 0.69
52 0.63
53 0.52
54 0.5
55 0.46
56 0.41
57 0.32
58 0.27
59 0.21
60 0.2
61 0.21
62 0.21
63 0.25
64 0.3
65 0.38
66 0.43
67 0.48
68 0.5
69 0.51
70 0.54
71 0.48
72 0.46
73 0.46
74 0.47
75 0.5
76 0.51
77 0.51
78 0.51
79 0.53
80 0.54
81 0.5
82 0.45
83 0.45
84 0.52
85 0.58
86 0.62
87 0.63
88 0.66
89 0.69