Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8BYS3

Protein Details
Accession S8BYS3    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
44-64KSAPRKIRKLVPKTEKHKQLMBasic
NLS Segment(s)
PositionSequence
44-56KSAPRKIRKLVPK
Subcellular Location(s) nucl 18.5, mito_nucl 12.166, cyto_nucl 11.833, mito 4.5
Family & Domain DBs
Amino Acid Sequences MSQRLPSSTWKETSQSLSSLTIEEEAKDIEEVQYFNKGQKVMGKSAPRKIRKLVPKTEKHKQLMWFLTNPDPRGEKLPIYEDGAKVAEDSGTIEQFRRLKGCKLRITDLRTGKKTYFLACMSDDPFVRSITQCPETTISKDIKNLILGKSRQGRVWCHDASVYSQATTVGGRLKNKYAQSGKNDFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.35
3 0.31
4 0.29
5 0.27
6 0.24
7 0.21
8 0.18
9 0.16
10 0.14
11 0.13
12 0.11
13 0.11
14 0.11
15 0.11
16 0.09
17 0.1
18 0.11
19 0.11
20 0.17
21 0.16
22 0.18
23 0.21
24 0.2
25 0.2
26 0.26
27 0.3
28 0.28
29 0.35
30 0.42
31 0.44
32 0.53
33 0.61
34 0.6
35 0.6
36 0.6
37 0.62
38 0.63
39 0.66
40 0.68
41 0.69
42 0.73
43 0.77
44 0.81
45 0.81
46 0.74
47 0.71
48 0.64
49 0.62
50 0.58
51 0.53
52 0.46
53 0.39
54 0.44
55 0.41
56 0.38
57 0.32
58 0.28
59 0.25
60 0.27
61 0.26
62 0.19
63 0.18
64 0.2
65 0.19
66 0.22
67 0.23
68 0.18
69 0.18
70 0.17
71 0.15
72 0.12
73 0.11
74 0.07
75 0.05
76 0.06
77 0.06
78 0.06
79 0.06
80 0.07
81 0.1
82 0.11
83 0.12
84 0.14
85 0.15
86 0.21
87 0.28
88 0.37
89 0.4
90 0.42
91 0.47
92 0.5
93 0.54
94 0.55
95 0.57
96 0.55
97 0.52
98 0.51
99 0.46
100 0.44
101 0.4
102 0.34
103 0.31
104 0.24
105 0.24
106 0.22
107 0.24
108 0.21
109 0.21
110 0.19
111 0.16
112 0.16
113 0.15
114 0.14
115 0.13
116 0.14
117 0.17
118 0.21
119 0.2
120 0.21
121 0.24
122 0.25
123 0.26
124 0.29
125 0.26
126 0.24
127 0.27
128 0.27
129 0.25
130 0.27
131 0.27
132 0.26
133 0.31
134 0.3
135 0.35
136 0.41
137 0.41
138 0.41
139 0.43
140 0.44
141 0.42
142 0.49
143 0.42
144 0.36
145 0.35
146 0.32
147 0.32
148 0.33
149 0.28
150 0.2
151 0.2
152 0.18
153 0.17
154 0.16
155 0.14
156 0.15
157 0.18
158 0.23
159 0.26
160 0.32
161 0.38
162 0.4
163 0.48
164 0.5
165 0.53
166 0.58