Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S8C3Y5

Protein Details
Accession S8C3Y5    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
81-106GSSSPAEKAKKKRSRKKKGTGAAGEDBasic
NLS Segment(s)
PositionSequence
86-99AEKAKKKRSRKKKG
161-170KAKGLQKKIR
Subcellular Location(s) nucl 13.5, mito 10, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR039333  PYM1  
IPR015362  WIBG_mago-bd  
IPR036348  WIBG_N_sf  
Gene Ontology GO:1903259  P:exon-exon junction complex disassembly  
Pfam View protein in Pfam  
PF09282  Mago-bind  
Amino Acid Sequences MASKEPKNPQTTTSGIQTLASGTRIIPSSVRADGTTRPERRVKPGFTPAEDVVKYQNRTAEAYRNRGSAGVPGAAEVPGAGSSSPAEKAKKKRSRKKKGTGAAGEDDKDEGEEGEDVAAVATDAPPPTSESAATKTTEAEQSSEPAASSSSPSTNADAEKKAKGLQKKIRQAQELKSRKDKGETLLPEQLDKALKLGELIRDLEKLGVTYEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.31
3 0.3
4 0.27
5 0.23
6 0.2
7 0.17
8 0.12
9 0.1
10 0.13
11 0.13
12 0.14
13 0.13
14 0.14
15 0.17
16 0.18
17 0.2
18 0.17
19 0.19
20 0.23
21 0.3
22 0.37
23 0.37
24 0.4
25 0.47
26 0.49
27 0.56
28 0.6
29 0.56
30 0.54
31 0.61
32 0.6
33 0.55
34 0.57
35 0.5
36 0.48
37 0.43
38 0.36
39 0.33
40 0.35
41 0.33
42 0.29
43 0.31
44 0.26
45 0.29
46 0.31
47 0.34
48 0.33
49 0.39
50 0.39
51 0.37
52 0.36
53 0.33
54 0.31
55 0.24
56 0.2
57 0.14
58 0.12
59 0.11
60 0.11
61 0.11
62 0.1
63 0.07
64 0.05
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.05
71 0.07
72 0.1
73 0.13
74 0.19
75 0.29
76 0.39
77 0.49
78 0.59
79 0.68
80 0.77
81 0.85
82 0.89
83 0.91
84 0.9
85 0.88
86 0.87
87 0.8
88 0.73
89 0.65
90 0.55
91 0.45
92 0.35
93 0.27
94 0.17
95 0.13
96 0.09
97 0.05
98 0.04
99 0.04
100 0.04
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.02
107 0.02
108 0.03
109 0.04
110 0.04
111 0.04
112 0.05
113 0.06
114 0.07
115 0.08
116 0.09
117 0.09
118 0.13
119 0.15
120 0.15
121 0.14
122 0.14
123 0.15
124 0.18
125 0.16
126 0.15
127 0.14
128 0.15
129 0.15
130 0.15
131 0.13
132 0.1
133 0.1
134 0.08
135 0.09
136 0.09
137 0.09
138 0.11
139 0.13
140 0.14
141 0.15
142 0.18
143 0.19
144 0.22
145 0.24
146 0.24
147 0.24
148 0.27
149 0.31
150 0.36
151 0.43
152 0.49
153 0.56
154 0.65
155 0.72
156 0.74
157 0.76
158 0.75
159 0.74
160 0.75
161 0.74
162 0.71
163 0.72
164 0.69
165 0.64
166 0.65
167 0.59
168 0.53
169 0.54
170 0.52
171 0.49
172 0.5
173 0.48
174 0.43
175 0.4
176 0.38
177 0.3
178 0.25
179 0.2
180 0.15
181 0.14
182 0.15
183 0.17
184 0.17
185 0.18
186 0.2
187 0.21
188 0.2
189 0.21
190 0.2
191 0.18
192 0.15