Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q5AL36

Protein Details
Accession Q5AL36    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
151-179QEPGTKAATKPKRRAPRKKLTESQKKAHNHydrophilic
NLS Segment(s)
PositionSequence
148-184KIKQEPGTKAATKPKRRAPRKKLTESQKKAHNKIEKR
Subcellular Location(s) nucl 23, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR011598  bHLH_dom  
IPR036638  HLH_DNA-bd_sf  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0046983  F:protein dimerization activity  
GO:0043565  F:sequence-specific DNA binding  
GO:0005975  P:carbohydrate metabolic process  
GO:0045991  P:carbon catabolite activation of transcription  
GO:0071456  P:cellular response to hypoxia  
GO:0030447  P:filamentous growth  
GO:0044182  P:filamentous growth of a population of unicellular organisms  
GO:1900429  P:negative regulation of filamentous growth of a population of unicellular organisms  
GO:0045821  P:positive regulation of glycolytic process  
GO:1900233  P:positive regulation of single-species biofilm formation on inanimate substrate  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
GO:0044011  P:single-species biofilm formation on inanimate substrate  
GO:0006368  P:transcription elongation by RNA polymerase II  
KEGG cal:CAALFM_C113140CA  -  
Pfam View protein in Pfam  
PF00010  HLH  
PROSITE View protein in PROSITE  
PS50888  BHLH  
CDD cd11395  bHLHzip_SREBP_like  
Amino Acid Sequences MSSFQQENQLNANNNNNNVMNEYISYSVPLSPVTTNENPQDYWMNGLIANSVPISQTTSNSDINYSQPPNPINFNSIFEGVNIFSNDDFTSSSNDISLANSPETNATSDSIAQNLDEVKVKLENHNQARLDALEFAFETKSILKEQPKIKQEPGTKAATKPKRRAPRKKLTESQKKAHNKIEKRYRININAKIAGIQKIIPWVAFEKTAFETGEENETEAEAKNNTRLNKSMILEKATEYILHLQKKEEEYMAENQKLREQVIKLGGEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.44
3 0.4
4 0.35
5 0.33
6 0.3
7 0.22
8 0.19
9 0.19
10 0.16
11 0.15
12 0.15
13 0.14
14 0.13
15 0.13
16 0.12
17 0.12
18 0.12
19 0.13
20 0.2
21 0.22
22 0.25
23 0.28
24 0.3
25 0.28
26 0.3
27 0.32
28 0.25
29 0.25
30 0.22
31 0.19
32 0.17
33 0.17
34 0.15
35 0.12
36 0.12
37 0.09
38 0.08
39 0.07
40 0.07
41 0.11
42 0.11
43 0.13
44 0.16
45 0.2
46 0.22
47 0.22
48 0.23
49 0.2
50 0.22
51 0.26
52 0.25
53 0.23
54 0.26
55 0.27
56 0.27
57 0.31
58 0.29
59 0.27
60 0.26
61 0.26
62 0.24
63 0.24
64 0.22
65 0.18
66 0.18
67 0.14
68 0.15
69 0.12
70 0.1
71 0.09
72 0.1
73 0.1
74 0.09
75 0.09
76 0.08
77 0.12
78 0.12
79 0.12
80 0.11
81 0.12
82 0.11
83 0.11
84 0.13
85 0.1
86 0.1
87 0.1
88 0.1
89 0.11
90 0.11
91 0.11
92 0.1
93 0.09
94 0.09
95 0.1
96 0.1
97 0.1
98 0.09
99 0.08
100 0.08
101 0.07
102 0.08
103 0.08
104 0.08
105 0.08
106 0.11
107 0.12
108 0.15
109 0.21
110 0.27
111 0.29
112 0.34
113 0.33
114 0.31
115 0.31
116 0.27
117 0.22
118 0.15
119 0.12
120 0.07
121 0.07
122 0.07
123 0.07
124 0.06
125 0.06
126 0.05
127 0.07
128 0.08
129 0.12
130 0.14
131 0.21
132 0.26
133 0.33
134 0.38
135 0.41
136 0.42
137 0.46
138 0.48
139 0.48
140 0.47
141 0.45
142 0.41
143 0.41
144 0.49
145 0.5
146 0.54
147 0.54
148 0.59
149 0.65
150 0.74
151 0.81
152 0.82
153 0.83
154 0.86
155 0.88
156 0.88
157 0.88
158 0.88
159 0.84
160 0.8
161 0.79
162 0.77
163 0.72
164 0.72
165 0.71
166 0.66
167 0.7
168 0.74
169 0.74
170 0.71
171 0.74
172 0.73
173 0.73
174 0.75
175 0.71
176 0.67
177 0.6
178 0.54
179 0.49
180 0.43
181 0.36
182 0.28
183 0.22
184 0.16
185 0.16
186 0.17
187 0.14
188 0.13
189 0.13
190 0.13
191 0.14
192 0.14
193 0.14
194 0.15
195 0.18
196 0.16
197 0.15
198 0.16
199 0.15
200 0.19
201 0.16
202 0.15
203 0.12
204 0.13
205 0.12
206 0.11
207 0.12
208 0.1
209 0.11
210 0.16
211 0.2
212 0.23
213 0.26
214 0.28
215 0.31
216 0.36
217 0.37
218 0.39
219 0.38
220 0.38
221 0.36
222 0.34
223 0.31
224 0.25
225 0.24
226 0.18
227 0.23
228 0.27
229 0.3
230 0.3
231 0.31
232 0.36
233 0.39
234 0.4
235 0.33
236 0.29
237 0.28
238 0.36
239 0.42
240 0.42
241 0.41
242 0.39
243 0.42
244 0.42
245 0.4
246 0.37
247 0.31
248 0.33
249 0.37