Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8CE64

Protein Details
Accession S8CE64   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
149-168GDPKKGKAYKKKALNAKTKTBasic
NLS Segment(s)
PositionSequence
152-160KKGKAYKKK
Subcellular Location(s) extr 13, mito 7, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
IPR000675  Cutinase/axe  
IPR011150  Cutinase_monf  
Gene Ontology GO:0005576  C:extracellular region  
GO:0050525  F:cutinase activity  
Pfam View protein in Pfam  
PF01083  Cutinase  
Amino Acid Sequences MRFSIATIALFSLLQCLEAAPAGNILPRQNTRNDLQNGACKKYTLIFARGTAEPAGNLGSVGAPFAAALEDVLGDDLAVQGVAYAASIQGAISGDPVGNKAMAAWVAKACGSTKIILGGYSQGAQLTHGAVRLMSASDAKKIDAIVTFGDPKKGKAYKKKALNAKTKTYCHAGDTICSVSCKKTNIACLQKNMQIKPAHKTYPDDVKAAARWVKSMVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.08
4 0.08
5 0.09
6 0.09
7 0.07
8 0.08
9 0.08
10 0.09
11 0.11
12 0.12
13 0.18
14 0.21
15 0.23
16 0.27
17 0.31
18 0.32
19 0.4
20 0.41
21 0.4
22 0.4
23 0.46
24 0.46
25 0.46
26 0.44
27 0.34
28 0.32
29 0.3
30 0.34
31 0.3
32 0.3
33 0.27
34 0.28
35 0.32
36 0.31
37 0.3
38 0.24
39 0.2
40 0.15
41 0.14
42 0.13
43 0.08
44 0.08
45 0.06
46 0.05
47 0.05
48 0.05
49 0.04
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.02
66 0.02
67 0.02
68 0.02
69 0.02
70 0.02
71 0.02
72 0.02
73 0.02
74 0.03
75 0.02
76 0.03
77 0.03
78 0.03
79 0.04
80 0.04
81 0.04
82 0.04
83 0.05
84 0.05
85 0.05
86 0.05
87 0.04
88 0.04
89 0.05
90 0.06
91 0.06
92 0.05
93 0.06
94 0.06
95 0.07
96 0.07
97 0.07
98 0.08
99 0.08
100 0.08
101 0.09
102 0.09
103 0.09
104 0.09
105 0.08
106 0.08
107 0.08
108 0.08
109 0.06
110 0.06
111 0.06
112 0.06
113 0.06
114 0.06
115 0.06
116 0.06
117 0.06
118 0.06
119 0.06
120 0.06
121 0.05
122 0.08
123 0.08
124 0.11
125 0.11
126 0.11
127 0.12
128 0.12
129 0.12
130 0.1
131 0.11
132 0.09
133 0.1
134 0.15
135 0.14
136 0.2
137 0.2
138 0.2
139 0.27
140 0.32
141 0.38
142 0.45
143 0.55
144 0.58
145 0.67
146 0.74
147 0.75
148 0.79
149 0.81
150 0.77
151 0.77
152 0.76
153 0.69
154 0.65
155 0.6
156 0.52
157 0.44
158 0.43
159 0.33
160 0.27
161 0.28
162 0.26
163 0.22
164 0.22
165 0.21
166 0.19
167 0.22
168 0.23
169 0.24
170 0.27
171 0.34
172 0.42
173 0.51
174 0.53
175 0.56
176 0.59
177 0.61
178 0.63
179 0.56
180 0.54
181 0.51
182 0.48
183 0.49
184 0.51
185 0.5
186 0.47
187 0.51
188 0.5
189 0.54
190 0.54
191 0.48
192 0.42
193 0.42
194 0.4
195 0.42
196 0.4
197 0.3
198 0.28