Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8BWS5

Protein Details
Accession S8BWS5    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
181-208ITALTVHKIRNRRRKRRVLKRLEGLQGGHydrophilic
NLS Segment(s)
PositionSequence
188-201KIRNRRRKRRVLKR
Subcellular Location(s) nucl 13, extr 5, plas 4, cyto 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSQLSPQTGCDAGNLPCYCNNSTNLALLENCVGANCTGGFGGFGGGGGQRGGFFSQFICSSLNSVTTSSSGVVILTTTTSIGGNTQNQILTEINNGNRQSLPATDISSSSRGGSETRRSETVAQGSDTKLATPRTNTANPTSTTTMPTNYVTTPPPFPNQPKPAAAIIGGTIGGISAAVCITALTVHKIRNRRRKRRVLKRLEGLQGGNFIDGDRDNDVNAIVGTGVDETSQSIWSGGPVVSFILDGRRGTTFSEGSRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.27
4 0.31
5 0.32
6 0.32
7 0.32
8 0.29
9 0.3
10 0.31
11 0.28
12 0.26
13 0.23
14 0.21
15 0.19
16 0.14
17 0.13
18 0.1
19 0.1
20 0.08
21 0.09
22 0.08
23 0.07
24 0.07
25 0.07
26 0.07
27 0.06
28 0.06
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.05
35 0.05
36 0.05
37 0.06
38 0.07
39 0.07
40 0.07
41 0.07
42 0.1
43 0.1
44 0.11
45 0.11
46 0.11
47 0.12
48 0.13
49 0.14
50 0.12
51 0.12
52 0.12
53 0.11
54 0.12
55 0.11
56 0.1
57 0.08
58 0.07
59 0.07
60 0.06
61 0.05
62 0.05
63 0.04
64 0.04
65 0.05
66 0.05
67 0.05
68 0.06
69 0.08
70 0.1
71 0.11
72 0.12
73 0.12
74 0.12
75 0.14
76 0.13
77 0.11
78 0.12
79 0.14
80 0.15
81 0.2
82 0.2
83 0.19
84 0.19
85 0.19
86 0.17
87 0.14
88 0.15
89 0.11
90 0.12
91 0.11
92 0.12
93 0.13
94 0.14
95 0.14
96 0.12
97 0.11
98 0.1
99 0.11
100 0.14
101 0.19
102 0.22
103 0.24
104 0.24
105 0.25
106 0.26
107 0.28
108 0.27
109 0.21
110 0.19
111 0.17
112 0.17
113 0.17
114 0.16
115 0.13
116 0.12
117 0.13
118 0.13
119 0.13
120 0.16
121 0.19
122 0.21
123 0.23
124 0.24
125 0.25
126 0.25
127 0.28
128 0.28
129 0.23
130 0.24
131 0.23
132 0.21
133 0.19
134 0.19
135 0.17
136 0.14
137 0.16
138 0.14
139 0.16
140 0.18
141 0.18
142 0.2
143 0.23
144 0.27
145 0.34
146 0.38
147 0.39
148 0.37
149 0.38
150 0.36
151 0.32
152 0.27
153 0.19
154 0.14
155 0.1
156 0.09
157 0.06
158 0.05
159 0.04
160 0.03
161 0.03
162 0.02
163 0.02
164 0.02
165 0.02
166 0.02
167 0.02
168 0.03
169 0.04
170 0.05
171 0.08
172 0.11
173 0.15
174 0.2
175 0.3
176 0.4
177 0.5
178 0.61
179 0.69
180 0.77
181 0.84
182 0.91
183 0.93
184 0.95
185 0.95
186 0.93
187 0.91
188 0.88
189 0.82
190 0.74
191 0.64
192 0.54
193 0.46
194 0.37
195 0.27
196 0.19
197 0.14
198 0.12
199 0.11
200 0.12
201 0.12
202 0.11
203 0.11
204 0.12
205 0.12
206 0.11
207 0.1
208 0.08
209 0.05
210 0.05
211 0.05
212 0.05
213 0.05
214 0.04
215 0.05
216 0.06
217 0.07
218 0.08
219 0.08
220 0.08
221 0.08
222 0.08
223 0.1
224 0.09
225 0.08
226 0.08
227 0.08
228 0.08
229 0.08
230 0.08
231 0.11
232 0.14
233 0.14
234 0.16
235 0.17
236 0.18
237 0.2
238 0.24
239 0.23