Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8B9X3

Protein Details
Accession S8B9X3   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
364-399GYIREKRRSIDYKKEKGVPGIQGKRIPRRIEKRWTGBasic
NLS Segment(s)
PositionSequence
367-397REKRRSIDYKKEKGVPGIQGKRIPRRIEKRW
Subcellular Location(s) nucl 19, cyto_nucl 13, cyto 5
Family & Domain DBs
Amino Acid Sequences MISNVSKPPTRTSITPSENHEASHAETTTIPLPTYASSFTIPAPRPVEKRDPFFGFHFRFYLPSLPKYMPPIKYAPYSGYYKRQISKGGQGMGDQQQRQQQGQGDGDVVTSVTSGAVSSSTVASGTAGTITTVVKIIHTSTRVTQTAKYTNSTLSASRTITITTQTSKPTISSIHPPSNISASQSIFKSGRREDKLAVTKVPDETEPVVSQSKTDFKFPSLSDIRAPFTRTPFARIPATTASPPPSSPTTTEIRPDTTFKTSVSTSSTLSSTPTPTETEIKPPKRPPEKECLRCREYSPGHPFYHKRSSVSSRGGIHTSFQARVYEAAGNIRRWLGVRIPWLPVSFHRHGYKNQEKGLTGKIIGYIREKRRSIDYKKEKGVPGIQGKRIPRRIEKRWTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.54
3 0.55
4 0.56
5 0.52
6 0.49
7 0.44
8 0.35
9 0.32
10 0.33
11 0.26
12 0.2
13 0.19
14 0.22
15 0.24
16 0.22
17 0.19
18 0.14
19 0.15
20 0.15
21 0.17
22 0.16
23 0.14
24 0.15
25 0.16
26 0.18
27 0.25
28 0.25
29 0.3
30 0.33
31 0.37
32 0.4
33 0.46
34 0.54
35 0.52
36 0.57
37 0.57
38 0.56
39 0.54
40 0.54
41 0.57
42 0.5
43 0.46
44 0.43
45 0.36
46 0.34
47 0.33
48 0.37
49 0.31
50 0.3
51 0.32
52 0.32
53 0.34
54 0.4
55 0.45
56 0.39
57 0.39
58 0.4
59 0.39
60 0.41
61 0.4
62 0.36
63 0.33
64 0.36
65 0.36
66 0.41
67 0.44
68 0.46
69 0.49
70 0.49
71 0.5
72 0.49
73 0.53
74 0.5
75 0.47
76 0.42
77 0.38
78 0.4
79 0.41
80 0.43
81 0.35
82 0.32
83 0.34
84 0.36
85 0.36
86 0.34
87 0.31
88 0.3
89 0.31
90 0.28
91 0.24
92 0.21
93 0.21
94 0.17
95 0.12
96 0.07
97 0.06
98 0.05
99 0.04
100 0.03
101 0.03
102 0.03
103 0.04
104 0.04
105 0.05
106 0.05
107 0.05
108 0.05
109 0.05
110 0.05
111 0.05
112 0.05
113 0.05
114 0.04
115 0.04
116 0.05
117 0.05
118 0.05
119 0.07
120 0.06
121 0.06
122 0.07
123 0.08
124 0.11
125 0.12
126 0.14
127 0.15
128 0.21
129 0.22
130 0.24
131 0.25
132 0.27
133 0.32
134 0.33
135 0.32
136 0.28
137 0.27
138 0.27
139 0.26
140 0.21
141 0.18
142 0.19
143 0.17
144 0.16
145 0.16
146 0.14
147 0.13
148 0.14
149 0.13
150 0.13
151 0.15
152 0.16
153 0.17
154 0.17
155 0.16
156 0.16
157 0.16
158 0.15
159 0.21
160 0.25
161 0.29
162 0.3
163 0.3
164 0.3
165 0.3
166 0.28
167 0.22
168 0.18
169 0.14
170 0.16
171 0.15
172 0.17
173 0.15
174 0.17
175 0.2
176 0.22
177 0.3
178 0.31
179 0.33
180 0.32
181 0.39
182 0.44
183 0.41
184 0.38
185 0.31
186 0.28
187 0.27
188 0.26
189 0.18
190 0.13
191 0.13
192 0.13
193 0.12
194 0.13
195 0.14
196 0.13
197 0.13
198 0.13
199 0.17
200 0.16
201 0.2
202 0.18
203 0.18
204 0.23
205 0.22
206 0.29
207 0.25
208 0.25
209 0.25
210 0.26
211 0.27
212 0.24
213 0.27
214 0.21
215 0.22
216 0.26
217 0.23
218 0.27
219 0.27
220 0.29
221 0.29
222 0.27
223 0.28
224 0.25
225 0.27
226 0.22
227 0.22
228 0.22
229 0.2
230 0.2
231 0.2
232 0.19
233 0.19
234 0.19
235 0.21
236 0.21
237 0.22
238 0.26
239 0.24
240 0.25
241 0.25
242 0.26
243 0.26
244 0.26
245 0.26
246 0.22
247 0.24
248 0.21
249 0.2
250 0.22
251 0.2
252 0.17
253 0.18
254 0.18
255 0.15
256 0.16
257 0.16
258 0.14
259 0.14
260 0.14
261 0.14
262 0.16
263 0.2
264 0.19
265 0.28
266 0.36
267 0.41
268 0.47
269 0.52
270 0.6
271 0.66
272 0.71
273 0.67
274 0.68
275 0.73
276 0.76
277 0.79
278 0.78
279 0.72
280 0.69
281 0.65
282 0.64
283 0.58
284 0.59
285 0.58
286 0.56
287 0.53
288 0.57
289 0.58
290 0.55
291 0.6
292 0.53
293 0.46
294 0.47
295 0.51
296 0.53
297 0.55
298 0.53
299 0.46
300 0.47
301 0.46
302 0.4
303 0.34
304 0.33
305 0.3
306 0.26
307 0.24
308 0.22
309 0.21
310 0.21
311 0.22
312 0.18
313 0.16
314 0.22
315 0.24
316 0.24
317 0.25
318 0.24
319 0.23
320 0.22
321 0.24
322 0.21
323 0.22
324 0.27
325 0.29
326 0.32
327 0.33
328 0.33
329 0.33
330 0.34
331 0.37
332 0.35
333 0.39
334 0.41
335 0.43
336 0.48
337 0.57
338 0.61
339 0.6
340 0.62
341 0.59
342 0.55
343 0.54
344 0.54
345 0.47
346 0.38
347 0.31
348 0.31
349 0.28
350 0.3
351 0.34
352 0.37
353 0.43
354 0.51
355 0.52
356 0.5
357 0.58
358 0.65
359 0.66
360 0.68
361 0.7
362 0.71
363 0.78
364 0.82
365 0.76
366 0.73
367 0.71
368 0.69
369 0.69
370 0.67
371 0.65
372 0.64
373 0.69
374 0.73
375 0.74
376 0.72
377 0.72
378 0.74
379 0.77