Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8A619

Protein Details
Accession S8A619    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MPYRRTHRRTRPATVRTTRTKHydrophilic
NLS Segment(s)
PositionSequence
78-110KIKGSLTRRPGLKAAGTRRQRGTDGRGSHRRRW
Subcellular Location(s) mito 14, cyto 7.5, cyto_nucl 7, nucl 5.5
Family & Domain DBs
Amino Acid Sequences MPYRRTHRRTRPATVRTTRTKPSLMDRLTGRRSHTTVTTTRATHGHGHHHHHVAPVAPVHHQKRKPTLSDKVSGALMKIKGSLTRRPGLKAAGTRRQRGTDGRGSHRRRW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.81
3 0.79
4 0.77
5 0.72
6 0.66
7 0.61
8 0.54
9 0.53
10 0.54
11 0.47
12 0.45
13 0.44
14 0.48
15 0.49
16 0.49
17 0.45
18 0.4
19 0.4
20 0.37
21 0.36
22 0.32
23 0.3
24 0.32
25 0.32
26 0.27
27 0.27
28 0.26
29 0.26
30 0.26
31 0.26
32 0.3
33 0.3
34 0.36
35 0.38
36 0.39
37 0.38
38 0.33
39 0.32
40 0.24
41 0.2
42 0.15
43 0.12
44 0.12
45 0.17
46 0.21
47 0.28
48 0.3
49 0.34
50 0.42
51 0.46
52 0.5
53 0.51
54 0.55
55 0.52
56 0.54
57 0.5
58 0.43
59 0.4
60 0.34
61 0.27
62 0.23
63 0.19
64 0.15
65 0.15
66 0.14
67 0.17
68 0.21
69 0.27
70 0.28
71 0.34
72 0.36
73 0.38
74 0.4
75 0.38
76 0.4
77 0.42
78 0.45
79 0.49
80 0.53
81 0.57
82 0.59
83 0.59
84 0.57
85 0.55
86 0.54
87 0.53
88 0.55
89 0.58
90 0.64