Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8C1F1

Protein Details
Accession S8C1F1   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
94-121ELNTPDKKLQPKSQKKDKIKGSSSKLKGHydrophilic
NLS Segment(s)
PositionSequence
105-113KSQKKDKIK
Subcellular Location(s) mito 8, extr 7, nucl 6, cyto_nucl 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR003732  Daa-tRNA_deacyls_DTD  
IPR023509  DTD-like_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0051499  F:D-aminoacyl-tRNA deacylase activity  
GO:0000049  F:tRNA binding  
Pfam View protein in Pfam  
PF02580  Tyr_Deacylase  
Amino Acid Sequences MKFWDDDQGGKWKRNVVDIDGDVLCVSQFTLLANTKKGSKPDFHGAMAPERAKALYETFFQKVQQGYQPERVKDGVFQAMMEVALVNDGPVTLELNTPDKKLQPKSQKKDKIKGSSSKLKGMETPGSSSDAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.43
3 0.37
4 0.4
5 0.36
6 0.38
7 0.31
8 0.3
9 0.23
10 0.2
11 0.16
12 0.09
13 0.08
14 0.04
15 0.04
16 0.04
17 0.09
18 0.13
19 0.16
20 0.18
21 0.19
22 0.23
23 0.26
24 0.3
25 0.29
26 0.28
27 0.32
28 0.39
29 0.4
30 0.37
31 0.36
32 0.34
33 0.34
34 0.34
35 0.29
36 0.2
37 0.18
38 0.17
39 0.14
40 0.14
41 0.12
42 0.1
43 0.11
44 0.14
45 0.16
46 0.16
47 0.16
48 0.18
49 0.17
50 0.16
51 0.18
52 0.19
53 0.21
54 0.29
55 0.32
56 0.3
57 0.31
58 0.31
59 0.27
60 0.24
61 0.23
62 0.17
63 0.13
64 0.13
65 0.11
66 0.1
67 0.09
68 0.08
69 0.06
70 0.03
71 0.03
72 0.03
73 0.03
74 0.02
75 0.02
76 0.03
77 0.03
78 0.04
79 0.05
80 0.06
81 0.07
82 0.13
83 0.14
84 0.15
85 0.17
86 0.2
87 0.27
88 0.33
89 0.41
90 0.48
91 0.58
92 0.67
93 0.76
94 0.82
95 0.85
96 0.88
97 0.88
98 0.87
99 0.84
100 0.84
101 0.81
102 0.81
103 0.76
104 0.74
105 0.67
106 0.58
107 0.53
108 0.5
109 0.48
110 0.4
111 0.4
112 0.34