Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8BR89

Protein Details
Accession S8BR89    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
79-100TTETDEEPKRKKQRGRKRKASTBasic
NLS Segment(s)
PositionSequence
86-99PKRKKQRGRKRKAS
Subcellular Location(s) nucl 21.5, cyto_nucl 14.333, mito_nucl 11.666
Family & Domain DBs
Amino Acid Sequences MAGKTTAISDEEFLLLCIKHAENIKINYTAVVRDLGYSSDKVASNRMRNLRKKLQSSKQEGGAGEDAEDETQVEQPTTTTETDEEPKRKKQRGRKRKAST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.1
3 0.09
4 0.11
5 0.1
6 0.13
7 0.16
8 0.2
9 0.24
10 0.27
11 0.3
12 0.29
13 0.29
14 0.27
15 0.24
16 0.21
17 0.15
18 0.13
19 0.1
20 0.09
21 0.1
22 0.1
23 0.11
24 0.1
25 0.1
26 0.12
27 0.13
28 0.13
29 0.19
30 0.23
31 0.26
32 0.31
33 0.39
34 0.44
35 0.49
36 0.56
37 0.59
38 0.61
39 0.65
40 0.68
41 0.69
42 0.69
43 0.71
44 0.67
45 0.62
46 0.58
47 0.49
48 0.44
49 0.36
50 0.27
51 0.19
52 0.16
53 0.12
54 0.09
55 0.09
56 0.06
57 0.05
58 0.07
59 0.07
60 0.07
61 0.07
62 0.07
63 0.09
64 0.12
65 0.11
66 0.1
67 0.11
68 0.14
69 0.21
70 0.29
71 0.35
72 0.38
73 0.48
74 0.56
75 0.64
76 0.71
77 0.76
78 0.8
79 0.83
80 0.89