Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S8B7X0

Protein Details
Accession S8B7X0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
67-87CQNCVSMKLKCKSRLSKDCKIHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 25
Family & Domain DBs
Amino Acid Sequences MQFSIIAVVATLAAVAQCAPQPVAEPGLIEWLTGEDSVPSWSMSDCRGAVSRSNPNPLTNDWCIKNCQNCVSMKLKCKSRLSKDCKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.04
4 0.05
5 0.06
6 0.06
7 0.07
8 0.09
9 0.1
10 0.12
11 0.11
12 0.1
13 0.1
14 0.14
15 0.14
16 0.12
17 0.1
18 0.09
19 0.09
20 0.09
21 0.09
22 0.04
23 0.05
24 0.06
25 0.06
26 0.06
27 0.05
28 0.06
29 0.06
30 0.07
31 0.08
32 0.08
33 0.08
34 0.1
35 0.11
36 0.13
37 0.17
38 0.25
39 0.26
40 0.32
41 0.32
42 0.32
43 0.34
44 0.33
45 0.35
46 0.31
47 0.33
48 0.29
49 0.3
50 0.34
51 0.36
52 0.4
53 0.37
54 0.37
55 0.37
56 0.36
57 0.4
58 0.43
59 0.44
60 0.47
61 0.52
62 0.56
63 0.6
64 0.68
65 0.73
66 0.76
67 0.81