Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S8A4Y6

Protein Details
Accession S8A4Y6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
6-28VFFMFHHIRARRKREHIRALAELHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, cyto_mito 12.333, cyto 3, plas 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR010541  Prp3_C  
IPR017359  UCP038021_RWD  
Pfam View protein in Pfam  
PF06544  DUF1115  
Amino Acid Sequences MIFSRVFFMFHHIRARRKREHIRALAELMSIRGVCKHGYPGFLYVEGEDVSIQKYLKEIKRMKWQSVEVRRKEQQELRDTDCTIDRKVQRLQGPFTVVEVDTSKELSEILRTAGLGDFLHKAMVGTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.65
3 0.67
4 0.73
5 0.79
6 0.8
7 0.85
8 0.83
9 0.8
10 0.75
11 0.68
12 0.58
13 0.48
14 0.38
15 0.28
16 0.21
17 0.14
18 0.11
19 0.09
20 0.1
21 0.09
22 0.1
23 0.16
24 0.16
25 0.18
26 0.19
27 0.21
28 0.21
29 0.21
30 0.2
31 0.14
32 0.13
33 0.11
34 0.1
35 0.07
36 0.06
37 0.07
38 0.08
39 0.07
40 0.06
41 0.08
42 0.14
43 0.17
44 0.26
45 0.29
46 0.34
47 0.45
48 0.48
49 0.5
50 0.48
51 0.5
52 0.5
53 0.56
54 0.6
55 0.52
56 0.56
57 0.58
58 0.56
59 0.57
60 0.52
61 0.48
62 0.47
63 0.48
64 0.46
65 0.45
66 0.42
67 0.38
68 0.38
69 0.33
70 0.27
71 0.29
72 0.27
73 0.29
74 0.32
75 0.37
76 0.38
77 0.41
78 0.43
79 0.39
80 0.4
81 0.35
82 0.32
83 0.28
84 0.22
85 0.19
86 0.16
87 0.14
88 0.12
89 0.12
90 0.11
91 0.09
92 0.1
93 0.08
94 0.1
95 0.09
96 0.1
97 0.1
98 0.1
99 0.11
100 0.12
101 0.12
102 0.1
103 0.11
104 0.12
105 0.11
106 0.12
107 0.11