Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8AI46

Protein Details
Accession S8AI46   
Localization Confidence High
Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
57-79QAYRDCKKKWIEERKAERWKKAFHydrophilic
NLS Segment(s)
PositionSequence
70-77RKAERWKK
Subcellular Location(s) nucl 20, cyto 4, mito 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MPEIQYRENPVDEEVKRQFNSKGSSKFFDPCQDAADRSLKCLKRNLGDREMCTDYFQAYRDCKKKWIEERKAERWKKAFGSSEKNEEGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.38
3 0.37
4 0.39
5 0.39
6 0.37
7 0.42
8 0.42
9 0.45
10 0.44
11 0.46
12 0.46
13 0.46
14 0.43
15 0.42
16 0.38
17 0.31
18 0.29
19 0.27
20 0.25
21 0.25
22 0.29
23 0.23
24 0.22
25 0.29
26 0.28
27 0.29
28 0.34
29 0.34
30 0.34
31 0.42
32 0.45
33 0.45
34 0.46
35 0.45
36 0.45
37 0.44
38 0.38
39 0.32
40 0.26
41 0.19
42 0.17
43 0.18
44 0.16
45 0.18
46 0.26
47 0.3
48 0.32
49 0.37
50 0.42
51 0.5
52 0.56
53 0.64
54 0.66
55 0.71
56 0.79
57 0.83
58 0.88
59 0.85
60 0.83
61 0.77
62 0.73
63 0.68
64 0.66
65 0.64
66 0.61
67 0.65
68 0.61
69 0.65