Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8ADH8

Protein Details
Accession S8ADH8   
Localization Confidence High
Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
71-96NISSTTSPTKRNKRGKKQLSPESRAKHydrophilic
125-147MEERTFSKRNRGKKPKASFIMENHydrophilic
NLS Segment(s)
PositionSequence
80-107KRNKRGKKQLSPESRAKKAKIEVEKDAK
132-140KRNRGKKPK
Subcellular Location(s) nucl 16, mito_nucl 12.333, cyto_nucl 10.333, mito 7.5
Family & Domain DBs
Amino Acid Sequences MKAMQRFEHQGPFLVSVIKHSELQTVSLTLPVDYGAIGAEHGITAHSAYCRFKNIKDALKLELNNVNTDENISSTTSPTKRNKRGKKQLSPESRAKKAKIEVEKDAKKGSAVNEASGFEVDKLDMEERTFSKRNRGKKPKASFIMENDGSEESEYYE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.25
3 0.21
4 0.25
5 0.23
6 0.23
7 0.21
8 0.25
9 0.22
10 0.24
11 0.22
12 0.19
13 0.17
14 0.17
15 0.17
16 0.12
17 0.12
18 0.1
19 0.08
20 0.07
21 0.06
22 0.04
23 0.04
24 0.04
25 0.04
26 0.04
27 0.03
28 0.03
29 0.04
30 0.03
31 0.04
32 0.05
33 0.06
34 0.09
35 0.11
36 0.12
37 0.18
38 0.2
39 0.21
40 0.29
41 0.34
42 0.39
43 0.42
44 0.43
45 0.4
46 0.44
47 0.43
48 0.37
49 0.35
50 0.28
51 0.24
52 0.23
53 0.19
54 0.14
55 0.15
56 0.12
57 0.08
58 0.08
59 0.08
60 0.07
61 0.08
62 0.13
63 0.14
64 0.21
65 0.28
66 0.37
67 0.46
68 0.56
69 0.66
70 0.73
71 0.82
72 0.85
73 0.87
74 0.87
75 0.87
76 0.86
77 0.82
78 0.8
79 0.76
80 0.73
81 0.68
82 0.6
83 0.55
84 0.51
85 0.52
86 0.51
87 0.49
88 0.49
89 0.54
90 0.57
91 0.53
92 0.5
93 0.42
94 0.35
95 0.33
96 0.27
97 0.26
98 0.22
99 0.22
100 0.22
101 0.22
102 0.22
103 0.2
104 0.19
105 0.1
106 0.1
107 0.08
108 0.07
109 0.08
110 0.09
111 0.09
112 0.1
113 0.13
114 0.14
115 0.21
116 0.27
117 0.26
118 0.36
119 0.42
120 0.51
121 0.59
122 0.69
123 0.73
124 0.77
125 0.86
126 0.86
127 0.87
128 0.84
129 0.79
130 0.74
131 0.73
132 0.64
133 0.54
134 0.46
135 0.39
136 0.33
137 0.27