Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8C0E2

Protein Details
Accession S8C0E2   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
145-167EPESPTKVLPRRKARLEPGRIRNHydrophilic
NLS Segment(s)
PositionSequence
87-102PMKKARTAKGKGKKRR
155-164RRKARLEPGR
Subcellular Location(s) extr 8, nucl 4.5, golg 4, cyto_nucl 3, vacu 3, mito 2, pero 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MEAPRKNIKWTPEADQNLLLAILAAGPSIDVATVAANAGLTTNNVAWRLHTLKKNAAKLRANNNGGTQPVTFSKKRAYPSSEASSSPMKKARTAKGKGKKRRVIDDTTDEESLKSLLGSETEAEETPCLQDEEGEEKETSPSSIEPESPTKVLPRRKARLEPGRIRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.47
3 0.42
4 0.35
5 0.3
6 0.23
7 0.13
8 0.08
9 0.06
10 0.04
11 0.04
12 0.03
13 0.03
14 0.03
15 0.03
16 0.03
17 0.03
18 0.03
19 0.04
20 0.04
21 0.04
22 0.04
23 0.04
24 0.04
25 0.04
26 0.04
27 0.04
28 0.06
29 0.06
30 0.08
31 0.09
32 0.1
33 0.1
34 0.15
35 0.19
36 0.24
37 0.28
38 0.31
39 0.38
40 0.45
41 0.53
42 0.52
43 0.56
44 0.56
45 0.58
46 0.63
47 0.64
48 0.59
49 0.52
50 0.49
51 0.42
52 0.36
53 0.32
54 0.23
55 0.15
56 0.16
57 0.2
58 0.18
59 0.18
60 0.22
61 0.25
62 0.29
63 0.32
64 0.33
65 0.32
66 0.38
67 0.41
68 0.38
69 0.34
70 0.33
71 0.34
72 0.3
73 0.29
74 0.28
75 0.23
76 0.27
77 0.32
78 0.38
79 0.42
80 0.47
81 0.55
82 0.6
83 0.7
84 0.75
85 0.8
86 0.79
87 0.75
88 0.78
89 0.73
90 0.69
91 0.65
92 0.61
93 0.56
94 0.52
95 0.47
96 0.38
97 0.32
98 0.26
99 0.2
100 0.14
101 0.08
102 0.05
103 0.05
104 0.05
105 0.06
106 0.06
107 0.07
108 0.09
109 0.09
110 0.09
111 0.09
112 0.09
113 0.09
114 0.09
115 0.09
116 0.07
117 0.08
118 0.1
119 0.15
120 0.16
121 0.18
122 0.17
123 0.17
124 0.19
125 0.19
126 0.16
127 0.12
128 0.11
129 0.12
130 0.14
131 0.15
132 0.18
133 0.22
134 0.26
135 0.25
136 0.26
137 0.3
138 0.36
139 0.44
140 0.5
141 0.56
142 0.61
143 0.69
144 0.77
145 0.8
146 0.83
147 0.85