Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8C2X3

Protein Details
Accession S8C2X3   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
73-99ISPPNKPLKKRKLAKIASPTKNKRVKQHydrophilic
NLS Segment(s)
PositionSequence
77-96NKPLKKRKLAKIASPTKNKR
Subcellular Location(s) mito 14, nucl 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MAKATFNPTSAGSQLFLLRLLKHIDLKTRKVNIEALAAEEGITNSSAVKKLHGIKAALIDKLGEMDGGNEQAISPPNKPLKKRKLAKIASPTKNKRVKQEVDEYSDEEEEENE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.16
4 0.15
5 0.14
6 0.15
7 0.17
8 0.18
9 0.23
10 0.24
11 0.32
12 0.36
13 0.41
14 0.47
15 0.49
16 0.48
17 0.45
18 0.46
19 0.38
20 0.36
21 0.3
22 0.24
23 0.19
24 0.18
25 0.15
26 0.12
27 0.1
28 0.07
29 0.07
30 0.05
31 0.05
32 0.06
33 0.08
34 0.08
35 0.09
36 0.12
37 0.16
38 0.2
39 0.23
40 0.22
41 0.21
42 0.27
43 0.28
44 0.24
45 0.19
46 0.16
47 0.13
48 0.13
49 0.12
50 0.05
51 0.04
52 0.04
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.06
59 0.09
60 0.1
61 0.11
62 0.17
63 0.25
64 0.3
65 0.37
66 0.46
67 0.54
68 0.63
69 0.71
70 0.74
71 0.77
72 0.78
73 0.81
74 0.81
75 0.81
76 0.8
77 0.82
78 0.79
79 0.78
80 0.82
81 0.76
82 0.75
83 0.74
84 0.72
85 0.69
86 0.72
87 0.69
88 0.66
89 0.65
90 0.58
91 0.51
92 0.44
93 0.37