Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8AFY5

Protein Details
Accession S8AFY5    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
37-69FQQYRPPKKTSDKPKRPPKQKKPSKPQIPDDYVHydrophilic
NLS Segment(s)
PositionSequence
42-61PPKKTSDKPKRPPKQKKPSK
Subcellular Location(s) nucl 13, mito 9, cyto 3
Family & Domain DBs
Amino Acid Sequences MALWNTGIPTAILPWNWGQLRCENRAGNGPFGGCIVFQQYRPPKKTSDKPKRPPKQKKPSKPQIPDDYVDETEPVQVVTLPDDYQYKKRAAEEDAPMDEAMQLRFKRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.21
3 0.23
4 0.24
5 0.23
6 0.28
7 0.34
8 0.36
9 0.41
10 0.35
11 0.34
12 0.42
13 0.41
14 0.36
15 0.32
16 0.27
17 0.21
18 0.21
19 0.19
20 0.1
21 0.08
22 0.11
23 0.11
24 0.11
25 0.19
26 0.28
27 0.36
28 0.39
29 0.41
30 0.43
31 0.5
32 0.59
33 0.62
34 0.65
35 0.68
36 0.74
37 0.83
38 0.88
39 0.9
40 0.93
41 0.93
42 0.92
43 0.92
44 0.93
45 0.93
46 0.93
47 0.93
48 0.89
49 0.86
50 0.84
51 0.77
52 0.68
53 0.6
54 0.53
55 0.43
56 0.36
57 0.28
58 0.19
59 0.15
60 0.13
61 0.1
62 0.06
63 0.06
64 0.06
65 0.07
66 0.08
67 0.08
68 0.09
69 0.13
70 0.16
71 0.2
72 0.24
73 0.25
74 0.26
75 0.29
76 0.32
77 0.34
78 0.38
79 0.4
80 0.42
81 0.41
82 0.4
83 0.37
84 0.33
85 0.29
86 0.23
87 0.18
88 0.2