Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S8AP95

Protein Details
Accession S8AP95    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
178-209LELFHRDIDKDRRKSKKQRRVGKSSKSFHDQEBasic
NLS Segment(s)
PositionSequence
187-201KDRRKSKKQRRVGKS
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MVTIKIYSSGTHYGPLKPPATLRYDLRKITNPPKHLRNLDARSKNLREHLLNESDFVGLLETIHNDILREVESLDSAGGTDKETTSPTQHIQQSLDEQESGESSRTANHASEETSLSEASARVAENPTTEESLGDSEILDSEDGPTITVNCFCHLGRHRSASMVEELGRLKWPKNIQLELFHRDIDKDRRKSKKQRRVGKSSKSFHDQEED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.39
3 0.36
4 0.33
5 0.36
6 0.35
7 0.38
8 0.38
9 0.38
10 0.42
11 0.47
12 0.49
13 0.51
14 0.54
15 0.56
16 0.62
17 0.65
18 0.63
19 0.64
20 0.68
21 0.71
22 0.68
23 0.67
24 0.66
25 0.65
26 0.68
27 0.67
28 0.64
29 0.64
30 0.64
31 0.61
32 0.56
33 0.53
34 0.45
35 0.42
36 0.43
37 0.4
38 0.37
39 0.34
40 0.3
41 0.24
42 0.22
43 0.18
44 0.12
45 0.06
46 0.06
47 0.06
48 0.05
49 0.06
50 0.07
51 0.07
52 0.06
53 0.07
54 0.07
55 0.07
56 0.07
57 0.07
58 0.06
59 0.06
60 0.06
61 0.06
62 0.05
63 0.04
64 0.05
65 0.05
66 0.05
67 0.06
68 0.06
69 0.07
70 0.08
71 0.1
72 0.11
73 0.13
74 0.14
75 0.2
76 0.21
77 0.22
78 0.22
79 0.22
80 0.22
81 0.22
82 0.21
83 0.15
84 0.13
85 0.11
86 0.1
87 0.1
88 0.08
89 0.06
90 0.05
91 0.07
92 0.08
93 0.09
94 0.08
95 0.09
96 0.09
97 0.09
98 0.11
99 0.11
100 0.1
101 0.1
102 0.09
103 0.09
104 0.08
105 0.07
106 0.07
107 0.07
108 0.06
109 0.06
110 0.08
111 0.08
112 0.08
113 0.1
114 0.11
115 0.11
116 0.11
117 0.1
118 0.09
119 0.1
120 0.1
121 0.08
122 0.06
123 0.05
124 0.06
125 0.06
126 0.05
127 0.04
128 0.05
129 0.06
130 0.06
131 0.06
132 0.06
133 0.06
134 0.07
135 0.1
136 0.1
137 0.1
138 0.12
139 0.12
140 0.2
141 0.25
142 0.31
143 0.33
144 0.37
145 0.37
146 0.37
147 0.38
148 0.33
149 0.29
150 0.25
151 0.21
152 0.18
153 0.18
154 0.17
155 0.21
156 0.2
157 0.19
158 0.23
159 0.27
160 0.32
161 0.38
162 0.42
163 0.4
164 0.48
165 0.52
166 0.51
167 0.48
168 0.42
169 0.36
170 0.33
171 0.37
172 0.39
173 0.43
174 0.48
175 0.56
176 0.65
177 0.75
178 0.84
179 0.89
180 0.89
181 0.89
182 0.91
183 0.91
184 0.92
185 0.92
186 0.92
187 0.91
188 0.88
189 0.85
190 0.82
191 0.74