Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8AA47

Protein Details
Accession S8AA47   
Localization Confidence Low
Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
211-233GPNDPNRRNPGRQQQRPQNRFSPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9.5, cyto_nucl 8.5, mito 7, cyto 6.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR024079  MetalloPept_cat_dom_sf  
IPR001818  Pept_M10_metallopeptidase  
IPR021190  Pept_M10A  
IPR006026  Peptidase_Metallo  
Gene Ontology GO:0031012  C:extracellular matrix  
GO:0004222  F:metalloendopeptidase activity  
GO:0008270  F:zinc ion binding  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF00413  Peptidase_M10  
Amino Acid Sequences MCHIFEEEIQETVENIQEDEKNIREFEDIYICTGSHCKRQTGGRKWAKGHVFRYRVSGVFPGSRPEIMEQAFQKAQQKWAKYMGFKFEKATGAPNLLIEVVDSNHPQFRGNGAAGVASSTGPTGGPSQIWLRGPSPRPWNFGGIHTIFLHELGHILGFAHSNNKNAIMAPTIQDMWSERQLTPNDSERAQAWASGGDQNAGKWTNGAEIGGPNDPNRRNPGRQQQRPQNRFSPAQQRQRFGPPSNRQPNRFNPAQQRQQPFPTRGRTQAPRYRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.14
4 0.15
5 0.17
6 0.21
7 0.23
8 0.23
9 0.23
10 0.23
11 0.22
12 0.21
13 0.22
14 0.24
15 0.22
16 0.22
17 0.22
18 0.21
19 0.2
20 0.25
21 0.25
22 0.27
23 0.3
24 0.3
25 0.33
26 0.43
27 0.53
28 0.56
29 0.65
30 0.66
31 0.7
32 0.71
33 0.75
34 0.74
35 0.71
36 0.69
37 0.68
38 0.63
39 0.57
40 0.59
41 0.54
42 0.46
43 0.4
44 0.35
45 0.28
46 0.28
47 0.28
48 0.25
49 0.24
50 0.24
51 0.23
52 0.22
53 0.22
54 0.19
55 0.23
56 0.2
57 0.23
58 0.24
59 0.25
60 0.3
61 0.28
62 0.35
63 0.36
64 0.37
65 0.35
66 0.42
67 0.44
68 0.42
69 0.43
70 0.44
71 0.44
72 0.42
73 0.41
74 0.36
75 0.34
76 0.3
77 0.3
78 0.22
79 0.2
80 0.19
81 0.17
82 0.14
83 0.12
84 0.11
85 0.08
86 0.07
87 0.05
88 0.07
89 0.07
90 0.08
91 0.09
92 0.1
93 0.11
94 0.1
95 0.11
96 0.13
97 0.13
98 0.12
99 0.11
100 0.1
101 0.1
102 0.09
103 0.08
104 0.05
105 0.04
106 0.04
107 0.04
108 0.03
109 0.04
110 0.05
111 0.05
112 0.05
113 0.07
114 0.08
115 0.11
116 0.12
117 0.13
118 0.13
119 0.18
120 0.21
121 0.25
122 0.33
123 0.33
124 0.36
125 0.35
126 0.38
127 0.33
128 0.32
129 0.32
130 0.23
131 0.23
132 0.19
133 0.18
134 0.14
135 0.13
136 0.12
137 0.07
138 0.06
139 0.05
140 0.04
141 0.04
142 0.04
143 0.04
144 0.04
145 0.05
146 0.1
147 0.11
148 0.12
149 0.13
150 0.13
151 0.13
152 0.13
153 0.14
154 0.1
155 0.1
156 0.1
157 0.11
158 0.1
159 0.1
160 0.1
161 0.11
162 0.13
163 0.16
164 0.17
165 0.16
166 0.22
167 0.23
168 0.26
169 0.27
170 0.31
171 0.29
172 0.27
173 0.28
174 0.23
175 0.25
176 0.22
177 0.19
178 0.13
179 0.12
180 0.13
181 0.14
182 0.13
183 0.11
184 0.11
185 0.11
186 0.14
187 0.14
188 0.12
189 0.1
190 0.11
191 0.11
192 0.11
193 0.11
194 0.09
195 0.09
196 0.11
197 0.13
198 0.14
199 0.14
200 0.2
201 0.22
202 0.25
203 0.32
204 0.36
205 0.4
206 0.49
207 0.58
208 0.63
209 0.71
210 0.78
211 0.81
212 0.86
213 0.86
214 0.83
215 0.79
216 0.74
217 0.69
218 0.66
219 0.66
220 0.65
221 0.7
222 0.69
223 0.65
224 0.64
225 0.68
226 0.68
227 0.63
228 0.65
229 0.63
230 0.68
231 0.76
232 0.79
233 0.75
234 0.76
235 0.79
236 0.76
237 0.73
238 0.7
239 0.7
240 0.72
241 0.77
242 0.78
243 0.76
244 0.74
245 0.77
246 0.77
247 0.72
248 0.7
249 0.69
250 0.66
251 0.65
252 0.69
253 0.68
254 0.7