Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S8C9T9

Protein Details
Accession S8C9T9    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MPSSRITYRRRNPYNTRSNRIRVHydrophilic
NLS Segment(s)
PositionSequence
107-114KEAAAKKK
Subcellular Location(s) nucl 13, mito 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MPSSRITYRRRNPYNTRSNRIRVVKTPGGNLRALHIKKRGSAPRCGDCKSKLAGVPALRPREYSQVSKPTKTVSRAYGGSRCGNCVQDRIVRAFLIEEQKIVKKVLKEAAAKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.85
3 0.84
4 0.81
5 0.79
6 0.78
7 0.76
8 0.7
9 0.65
10 0.64
11 0.62
12 0.57
13 0.57
14 0.54
15 0.49
16 0.46
17 0.4
18 0.34
19 0.36
20 0.35
21 0.34
22 0.34
23 0.33
24 0.34
25 0.43
26 0.48
27 0.43
28 0.5
29 0.51
30 0.53
31 0.56
32 0.55
33 0.51
34 0.44
35 0.44
36 0.37
37 0.33
38 0.27
39 0.24
40 0.25
41 0.22
42 0.27
43 0.29
44 0.3
45 0.28
46 0.27
47 0.27
48 0.3
49 0.31
50 0.29
51 0.29
52 0.36
53 0.39
54 0.39
55 0.38
56 0.36
57 0.38
58 0.38
59 0.36
60 0.29
61 0.31
62 0.32
63 0.35
64 0.34
65 0.33
66 0.36
67 0.33
68 0.33
69 0.3
70 0.32
71 0.29
72 0.27
73 0.27
74 0.26
75 0.28
76 0.28
77 0.28
78 0.24
79 0.23
80 0.22
81 0.23
82 0.24
83 0.22
84 0.2
85 0.21
86 0.25
87 0.27
88 0.28
89 0.27
90 0.24
91 0.3
92 0.35
93 0.4
94 0.44