Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S8BV70

Protein Details
Accession S8BV70    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
44-97MVKIKAKSTCTKKKGHPAKPTPKPPAPKVCKTVTKNKTHWKTKKVEKTKYLTKTHydrophilic
NLS Segment(s)
PositionSequence
55-74KKKGHPAKPTPKPPAPKVCK
78-81KNKT
84-84K
Subcellular Location(s) cyto 12, mito 7, cyto_pero 7
Family & Domain DBs
Amino Acid Sequences MSNLSILSSAVPLALAGGHGYANGKGMAKHSTTCTKKNGQRTTMVKIKAKSTCTKKKGHPAKPTPKPPAPKVCKTVTKNKTHWKTKKVEKTKYLTKTVSKTISVITTETKTEQTTVSVTVVSTVSALDKPESVSPASVESSSSAPAEDYGYGEDASTTEVVTSTSVASIEAVSSTSASPDEYGGDGYGDTPATADAASSTSAEVPTSSAEVPTSSAEVPTTSAEVPASSSAEVPTTSAEVPTTSAEVPTTSAASAEAVSTTSAGTDGVDGYGGDGYGDGGYGGDGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.04
4 0.05
5 0.05
6 0.06
7 0.07
8 0.07
9 0.09
10 0.1
11 0.11
12 0.11
13 0.14
14 0.18
15 0.18
16 0.21
17 0.25
18 0.33
19 0.38
20 0.43
21 0.48
22 0.53
23 0.58
24 0.66
25 0.7
26 0.65
27 0.68
28 0.67
29 0.68
30 0.66
31 0.66
32 0.61
33 0.55
34 0.57
35 0.54
36 0.55
37 0.56
38 0.58
39 0.62
40 0.63
41 0.69
42 0.7
43 0.75
44 0.8
45 0.81
46 0.82
47 0.82
48 0.86
49 0.88
50 0.9
51 0.88
52 0.85
53 0.82
54 0.8
55 0.8
56 0.77
57 0.74
58 0.7
59 0.69
60 0.71
61 0.69
62 0.71
63 0.69
64 0.7
65 0.71
66 0.76
67 0.78
68 0.8
69 0.82
70 0.8
71 0.8
72 0.81
73 0.84
74 0.84
75 0.83
76 0.8
77 0.8
78 0.81
79 0.78
80 0.74
81 0.68
82 0.63
83 0.58
84 0.56
85 0.51
86 0.42
87 0.36
88 0.31
89 0.28
90 0.24
91 0.2
92 0.17
93 0.14
94 0.15
95 0.15
96 0.15
97 0.13
98 0.13
99 0.13
100 0.11
101 0.11
102 0.11
103 0.1
104 0.09
105 0.08
106 0.09
107 0.08
108 0.07
109 0.06
110 0.05
111 0.06
112 0.06
113 0.07
114 0.06
115 0.06
116 0.07
117 0.08
118 0.09
119 0.09
120 0.08
121 0.08
122 0.09
123 0.1
124 0.09
125 0.08
126 0.08
127 0.08
128 0.09
129 0.08
130 0.07
131 0.06
132 0.06
133 0.07
134 0.06
135 0.06
136 0.05
137 0.06
138 0.06
139 0.06
140 0.06
141 0.05
142 0.06
143 0.05
144 0.05
145 0.04
146 0.04
147 0.04
148 0.05
149 0.05
150 0.04
151 0.04
152 0.04
153 0.04
154 0.05
155 0.04
156 0.04
157 0.04
158 0.04
159 0.04
160 0.05
161 0.05
162 0.05
163 0.05
164 0.05
165 0.05
166 0.05
167 0.06
168 0.06
169 0.06
170 0.06
171 0.06
172 0.06
173 0.06
174 0.06
175 0.05
176 0.04
177 0.04
178 0.04
179 0.04
180 0.04
181 0.04
182 0.04
183 0.05
184 0.05
185 0.05
186 0.06
187 0.06
188 0.07
189 0.07
190 0.06
191 0.06
192 0.06
193 0.08
194 0.08
195 0.08
196 0.08
197 0.08
198 0.09
199 0.09
200 0.11
201 0.09
202 0.09
203 0.09
204 0.09
205 0.1
206 0.1
207 0.11
208 0.09
209 0.1
210 0.09
211 0.09
212 0.1
213 0.1
214 0.11
215 0.09
216 0.09
217 0.09
218 0.1
219 0.1
220 0.09
221 0.09
222 0.1
223 0.1
224 0.09
225 0.09
226 0.09
227 0.1
228 0.11
229 0.12
230 0.11
231 0.11
232 0.11
233 0.11
234 0.12
235 0.12
236 0.11
237 0.09
238 0.09
239 0.09
240 0.09
241 0.09
242 0.08
243 0.07
244 0.06
245 0.07
246 0.07
247 0.06
248 0.06
249 0.06
250 0.06
251 0.05
252 0.06
253 0.06
254 0.06
255 0.06
256 0.06
257 0.06
258 0.07
259 0.06
260 0.06
261 0.05
262 0.06
263 0.05
264 0.05
265 0.04
266 0.04