Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8AQZ2

Protein Details
Accession S8AQZ2    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
33-54GDPRSKHKKVWKKLEAKVKRNLBasic
NLS Segment(s)
PositionSequence
35-55PRSKHKKVWKKLEAKVKRNLE
Subcellular Location(s) mito 15, cyto_mito 10, nucl 9
Family & Domain DBs
Amino Acid Sequences MVSRKRRAAGLKARQTFLAKPAPGFGQRLWIDGDPRSKHKKVWKKLEAKVKRNLERNPQWQAIVKRGKELEKSDREFFKQLRERTEAEERRKQQELQNVKNEEAADVEEPGVKKEPDIKDEPSVKQEVHVKEEFNEANG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.61
3 0.53
4 0.48
5 0.45
6 0.36
7 0.31
8 0.32
9 0.33
10 0.32
11 0.32
12 0.26
13 0.27
14 0.26
15 0.27
16 0.28
17 0.25
18 0.25
19 0.26
20 0.34
21 0.28
22 0.35
23 0.42
24 0.4
25 0.45
26 0.53
27 0.6
28 0.62
29 0.7
30 0.73
31 0.74
32 0.79
33 0.84
34 0.84
35 0.8
36 0.8
37 0.78
38 0.75
39 0.73
40 0.71
41 0.7
42 0.68
43 0.68
44 0.65
45 0.56
46 0.51
47 0.49
48 0.45
49 0.44
50 0.42
51 0.36
52 0.33
53 0.34
54 0.35
55 0.33
56 0.36
57 0.36
58 0.36
59 0.4
60 0.4
61 0.4
62 0.41
63 0.41
64 0.37
65 0.38
66 0.38
67 0.37
68 0.38
69 0.4
70 0.39
71 0.41
72 0.51
73 0.49
74 0.48
75 0.55
76 0.53
77 0.54
78 0.56
79 0.53
80 0.47
81 0.49
82 0.51
83 0.5
84 0.55
85 0.52
86 0.5
87 0.5
88 0.45
89 0.36
90 0.27
91 0.21
92 0.13
93 0.11
94 0.11
95 0.11
96 0.11
97 0.13
98 0.16
99 0.14
100 0.14
101 0.22
102 0.25
103 0.29
104 0.33
105 0.35
106 0.41
107 0.46
108 0.48
109 0.45
110 0.44
111 0.38
112 0.38
113 0.42
114 0.37
115 0.38
116 0.38
117 0.35
118 0.33
119 0.41