Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7XII4

Protein Details
Accession S7XII4    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
31-60AEYIRRYLKNERREKNRIKNKYFKKFNVKLHydrophilic
NLS Segment(s)
PositionSequence
42-50RREKNRIKN
Subcellular Location(s) nucl 16, mito 11
Family & Domain DBs
Amino Acid Sequences MHRRYPMENKHDNLGRSGKKVIKIKVGAYDAEYIRRYLKNERREKNRIKNKYFKKFNVKLVNDESKKYEEIEIEEKIIKYNENEEKIIKYNEIQIQEKKIMEREKLEKCAAEGMVNFIRDIHFKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.49
3 0.45
4 0.49
5 0.45
6 0.47
7 0.53
8 0.52
9 0.52
10 0.51
11 0.5
12 0.5
13 0.48
14 0.4
15 0.35
16 0.36
17 0.28
18 0.29
19 0.27
20 0.21
21 0.23
22 0.24
23 0.25
24 0.3
25 0.38
26 0.44
27 0.53
28 0.61
29 0.66
30 0.74
31 0.81
32 0.82
33 0.84
34 0.84
35 0.82
36 0.84
37 0.85
38 0.86
39 0.84
40 0.8
41 0.8
42 0.76
43 0.77
44 0.77
45 0.69
46 0.62
47 0.6
48 0.62
49 0.52
50 0.47
51 0.4
52 0.31
53 0.3
54 0.27
55 0.22
56 0.14
57 0.16
58 0.18
59 0.16
60 0.16
61 0.17
62 0.16
63 0.16
64 0.16
65 0.13
66 0.11
67 0.18
68 0.22
69 0.23
70 0.25
71 0.25
72 0.27
73 0.3
74 0.3
75 0.24
76 0.19
77 0.23
78 0.26
79 0.29
80 0.31
81 0.3
82 0.34
83 0.37
84 0.37
85 0.33
86 0.35
87 0.35
88 0.35
89 0.38
90 0.42
91 0.45
92 0.5
93 0.5
94 0.44
95 0.4
96 0.42
97 0.35
98 0.3
99 0.23
100 0.24
101 0.25
102 0.25
103 0.24
104 0.19
105 0.2