Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7WAW6

Protein Details
Accession S7WAW6    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
27-48LNSQELKKRKKEELKRFLEKKLBasic
NLS Segment(s)
PositionSequence
33-48KKRKKEELKRFLEKKL
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
Amino Acid Sequences MNNVIIFNVSLYIEDDFNYPDKIIQCLNSQELKKRKKEELKRFLEKKLSNRKNLEYLIEKNIMKKEDWNIRLNETHKILNNITYKNHYEGLLCHVVSHGLVAAAKKVDFILKKKLVNRLIVGEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.11
4 0.13
5 0.13
6 0.12
7 0.14
8 0.15
9 0.16
10 0.17
11 0.17
12 0.19
13 0.21
14 0.25
15 0.28
16 0.29
17 0.36
18 0.44
19 0.5
20 0.55
21 0.57
22 0.63
23 0.67
24 0.76
25 0.79
26 0.8
27 0.81
28 0.83
29 0.81
30 0.76
31 0.75
32 0.68
33 0.67
34 0.68
35 0.65
36 0.63
37 0.64
38 0.62
39 0.58
40 0.54
41 0.48
42 0.41
43 0.36
44 0.33
45 0.32
46 0.3
47 0.27
48 0.28
49 0.26
50 0.21
51 0.21
52 0.23
53 0.27
54 0.31
55 0.33
56 0.32
57 0.33
58 0.37
59 0.36
60 0.35
61 0.29
62 0.27
63 0.25
64 0.27
65 0.25
66 0.28
67 0.3
68 0.28
69 0.28
70 0.29
71 0.3
72 0.29
73 0.3
74 0.24
75 0.2
76 0.19
77 0.24
78 0.23
79 0.21
80 0.18
81 0.17
82 0.16
83 0.15
84 0.14
85 0.08
86 0.05
87 0.06
88 0.07
89 0.09
90 0.1
91 0.1
92 0.1
93 0.1
94 0.16
95 0.2
96 0.24
97 0.32
98 0.37
99 0.44
100 0.49
101 0.58
102 0.57
103 0.58
104 0.57