Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7XIP6

Protein Details
Accession S7XIP6    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
85-104NYDNRFTRPRRIERIPTKEEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR025715  FoP_C  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF13865  FoP_duplication  
Amino Acid Sequences MIRRNHNREFDRNDRNTRRGDKFDHSHSYTSNPERREYRNMNRSLDYYPRNNYRNSNRRFEDNGRIDFRSRGPSYGPSRRIGYNNYDNRFTRPRRIERIPTKEELDEELKKYMKGELVRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.74
3 0.74
4 0.73
5 0.71
6 0.66
7 0.64
8 0.62
9 0.61
10 0.63
11 0.63
12 0.58
13 0.52
14 0.47
15 0.46
16 0.44
17 0.46
18 0.44
19 0.37
20 0.39
21 0.42
22 0.46
23 0.5
24 0.52
25 0.54
26 0.58
27 0.61
28 0.59
29 0.56
30 0.53
31 0.47
32 0.45
33 0.39
34 0.34
35 0.34
36 0.38
37 0.38
38 0.38
39 0.42
40 0.46
41 0.52
42 0.53
43 0.55
44 0.5
45 0.52
46 0.55
47 0.53
48 0.52
49 0.47
50 0.47
51 0.43
52 0.42
53 0.39
54 0.35
55 0.33
56 0.3
57 0.26
58 0.22
59 0.21
60 0.27
61 0.34
62 0.41
63 0.42
64 0.37
65 0.39
66 0.41
67 0.42
68 0.39
69 0.39
70 0.4
71 0.45
72 0.45
73 0.48
74 0.46
75 0.49
76 0.54
77 0.5
78 0.5
79 0.52
80 0.58
81 0.61
82 0.68
83 0.73
84 0.75
85 0.81
86 0.76
87 0.71
88 0.66
89 0.59
90 0.52
91 0.46
92 0.42
93 0.37
94 0.34
95 0.35
96 0.32
97 0.31
98 0.31
99 0.29
100 0.28