Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7W9A7

Protein Details
Accession S7W9A7    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
65-84KEEEKVKKIEPPQKKFKQSTBasic
NLS Segment(s)
PositionSequence
64-78KKEEEKVKKIEPPQK
Subcellular Location(s) nucl 15, cyto_nucl 10.5, mito 8, cyto 4
Family & Domain DBs
Amino Acid Sequences MKYITKRDDKSLSIDKYPSYHRLYVKVIEENGCTILKVNKKDGLLYGLAEKEYQSPEEFFNEKKKEEEKVKKIEPPQKKFKQSTLFSFIKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.42
3 0.39
4 0.42
5 0.4
6 0.36
7 0.38
8 0.36
9 0.39
10 0.41
11 0.42
12 0.41
13 0.38
14 0.34
15 0.3
16 0.28
17 0.24
18 0.23
19 0.18
20 0.14
21 0.12
22 0.15
23 0.18
24 0.2
25 0.22
26 0.24
27 0.24
28 0.25
29 0.25
30 0.22
31 0.17
32 0.15
33 0.14
34 0.1
35 0.1
36 0.1
37 0.09
38 0.09
39 0.09
40 0.1
41 0.09
42 0.1
43 0.11
44 0.15
45 0.16
46 0.17
47 0.25
48 0.27
49 0.27
50 0.3
51 0.32
52 0.35
53 0.44
54 0.53
55 0.52
56 0.58
57 0.62
58 0.65
59 0.72
60 0.74
61 0.74
62 0.72
63 0.75
64 0.76
65 0.8
66 0.78
67 0.78
68 0.79
69 0.74
70 0.73
71 0.71