Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7WB00

Protein Details
Accession S7WB00   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-21NFSAFIKKLKKERNELRLITHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 13.5, cyto_nucl 10, mito 6, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR044612  ARL2/3  
IPR027417  P-loop_NTPase  
IPR006689  Small_GTPase_ARF/SAR  
Gene Ontology GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
Pfam View protein in Pfam  
PF00025  Arf  
PROSITE View protein in PROSITE  
PS51417  ARF  
Amino Acid Sequences MNFSAFIKKLKKERNELRLITIGLDNAGKTTILKSMFDITDIVYPTFGYLTHEVNFNDHILTILDIGGQKSIRKYWNNFFEKADGLIFVVDLTDTRDFIPYLQHVANDPFLDGVPLLILGNKWDLKEESDGLEICNRIEKAFDSEIVKCYPVSAKLNKNLNESFKWLTEKIESLEKIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.8
3 0.75
4 0.71
5 0.66
6 0.58
7 0.49
8 0.4
9 0.3
10 0.22
11 0.2
12 0.14
13 0.1
14 0.1
15 0.08
16 0.08
17 0.08
18 0.12
19 0.12
20 0.13
21 0.14
22 0.18
23 0.18
24 0.19
25 0.18
26 0.15
27 0.17
28 0.18
29 0.16
30 0.11
31 0.11
32 0.11
33 0.1
34 0.09
35 0.1
36 0.1
37 0.12
38 0.13
39 0.16
40 0.16
41 0.17
42 0.18
43 0.15
44 0.13
45 0.11
46 0.1
47 0.08
48 0.08
49 0.07
50 0.05
51 0.06
52 0.06
53 0.06
54 0.07
55 0.07
56 0.08
57 0.09
58 0.13
59 0.18
60 0.22
61 0.27
62 0.33
63 0.43
64 0.46
65 0.47
66 0.45
67 0.4
68 0.36
69 0.32
70 0.24
71 0.14
72 0.1
73 0.08
74 0.07
75 0.05
76 0.04
77 0.03
78 0.03
79 0.05
80 0.05
81 0.06
82 0.06
83 0.07
84 0.07
85 0.08
86 0.1
87 0.08
88 0.12
89 0.11
90 0.12
91 0.12
92 0.13
93 0.15
94 0.12
95 0.12
96 0.09
97 0.08
98 0.08
99 0.07
100 0.05
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.04
107 0.08
108 0.09
109 0.09
110 0.11
111 0.12
112 0.14
113 0.16
114 0.17
115 0.15
116 0.16
117 0.17
118 0.15
119 0.17
120 0.16
121 0.13
122 0.17
123 0.16
124 0.14
125 0.15
126 0.15
127 0.18
128 0.2
129 0.23
130 0.21
131 0.22
132 0.25
133 0.26
134 0.25
135 0.19
136 0.19
137 0.19
138 0.21
139 0.26
140 0.31
141 0.37
142 0.45
143 0.54
144 0.56
145 0.6
146 0.59
147 0.58
148 0.53
149 0.51
150 0.46
151 0.41
152 0.43
153 0.37
154 0.35
155 0.33
156 0.33
157 0.3
158 0.35